KEGG   Homo sapiens (human): 23366Help
Entry
23366             CDS       T01001                                 

Definition
(RefSeq) KIAA0895
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1704
Motif
Other DBs
NCBI-GeneID: 23366
NCBI-ProteinID: NP_001093895
HGNC: 22206
Ensembl: ENSG00000164542
Vega: OTTHUMG00000154939
UniProt: Q8NCT3
Position
7p14.2
AA seq 520 aa AA seqDB search
MAGCTRKLTHLRKRIHRPRRRTTRRWKRWFKFRKRKGEKRPRPNHKAVARRAKLKFSTSE
KLHWPEQELAKKSILNAEDSLIIDNKRSISHLSSGVLKDIFTTGTSSYNVLLQSKEEKKY
HSQKQSSSTYSKRCRKPSKSPNTSRSKDPRRMKALVPVTSSGTWYCLERRPAVFVTSSVS
SPVKFTHDISVTGNGIVLPPKPKSKVKWCHFSTLPKPKPQLSRSFEKGDDFSGKKFCILT
AIKPTNLEKEKLRFFKSDYTYNPQFEYANPALPSVLAKHSHASDRFLKQIVVHLTEDLLS
RASMTVVNGCPTLTINVSTAREHWLEGMLRHEIGTHYFRGINNLQQPWNSWTGRKKHELK
PNNPTEEGLASIHSVLFRKDPFLWRAALLYYTVYQASQMSFCELFKDIGRFVKDPNTRWD
YCVRAKRGWTDTSQPGCFSKDQVYLDGILQILRYRDTIDFHLLTALGKVSYEDVDRLKGL
AVTENMRVPHFLQDHGRYMEHLEKIMEVNELTDRELKDLI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggctggctgcacccgcaaactcactcacctccgtaaacggatccatcgccccaggcgt
cggactacgagacgatggaaacggtggttcaaattcaggaagagaaaaggagagaaaagg
ccaagacctaatcataaggcagtggcaagaagagctaaactcaagttctctacctcagaa
aagcttcactggcctgagcaagaacttgctaagaagtctattctaaatgcagaagattca
ttgatcattgacaacaaaagaagcatttcacatttgtcctcgggagtgctaaaagacatt
ttcacaactggaaccagtagttacaatgtcctactacagagcaaggaggaaaaaaagtat
cattcacaaaaacagtcttcctccacctactccaaaagatgtagaaaacccagcaaatct
cctaacacttctcgtagcaaagatcctcgcaggatgaaagccctggtgcctgtgacaagc
agtggtacttggtactgcctggagaggcggcctgctgtttttgtcactagttcagtgtca
agtcctgtaaagtttacacatgatatctctgttacagggaatggcatagtactgccacct
aaacccaaaagcaaggtcaagtggtgccatttctccactcttccaaagccaaagcctcag
ctgtctagaagctttgaaaagggagatgacttttctgggaagaaattttgtatattgact
gctataaaacccaccaacttagagaaagaaaaactgagattcttcaaatctgactatacc
tacaatcctcagtttgagtatgccaatcctgctctgccaagcgtattagctaagcatagc
cacgcatctgaccgatttcttaagcagattgtagttcatctcactgaggacctgctttcc
cgagcgtcaatgacagtagtaaatggatgtccgactctgactatcaatgtgtccactgca
cgtgagcattggctggagggaatgctgaggcatgaaataggtacacattattttcgaggt
attaacaacctccagcagccatggaacagttggactggacgtaaaaaacatgagctaaag
ccaaataatcccacagaggaaggactagcaagcattcacagtgttctgtttagaaaagac
ccttttttatggagggctgccctcctctactacactgtttatcaagccagccaaatgtct
ttttgtgaactctttaaagatattggcaggtttgtcaaggaccccaatacaagatgggat
tattgtgtacgggccaagaggggatggactgatacttcccaaccagggtgttttagtaaa
gaccaggtatacttggatggaattcttcaaatcctccgatacagagataccatagacttc
catctgctgactgctctcgggaaggtttcttatgaagatgtggatcgcttaaaaggattg
gcagttaccgaaaacatgagggtccctcatttcctgcaggaccatggccgatatatggaa
cacttagagaagatcatggaagtgaatgaactgactgacagggaactgaaagatcttata
tag

DBGET integrated database retrieval system