KEGG   Homo sapiens (human): 23368Help
Entry
23368             CDS       T01001                                 

Gene name
PPP1R13B, ASPP1, p53BP2-like, p85
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 13B
  KO
K17554  apoptosis-stimulating of p53 protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23368 (PPP1R13B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     23368 (PPP1R13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 SH3_1 Ank_3 Ank SH3_9 SH3_2 Ank_5
Motif
Other DBs
NCBI-GeneID: 23368
NCBI-ProteinID: NP_056131
OMIM: 606455
HGNC: 14950
Ensembl: ENSG00000088808
Vega: OTTHUMG00000171647
Pharos: Q96KQ4(Tbio)
UniProt: Q96KQ4
Position
14q32.33
AA seq 1090 aa AA seqDB search
MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDH
MMYEHLQKWGPRREEVKFFLRHEDSPTENSEQGGRQTQEQRTQRNVINVPGEKRTENGVG
NPRVELTLSELQDMAARQQQQIENQQQMLVAKEQRLHFLKQQERRQQQSISENEKLQKLK
ERVEAQENKLKKIRAMRGQVDYSKIMNGNLSAEIERFSAMFQEKKQEVQTAILRVDQLSQ
QLEDLKKGKLNGFQSYNGKLTGPAAVELKRLYQELQIRNQLNQEQNSKLQQQKELLNKRN
MEVAMMDKRISELRERLYGKKIQLNRVNGTSSPQSPLSTSGRVAAVGPYIQVPSAGSFPV
LGDPIKPQSLSIASNAAHGRSKSANDGNWPTLKQNSSSSVKPVQVAGADWKDPSVEGSVK
QGTVSSQPVPFSALGPTEKPGIEIGKVPPPIPGVGKQLPPSYGTYPSPTPLGPGSTSSLE
RRKEGSLPRPSAGLPSRQRPTLLPATGSTPQPGSSQQIQQRISVPPSPTYPPAGPPAFPA
GDSKPELPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQPAAHSA
LNKSVKAVYGKPVLPSGSTSPSPLPFLHGSLSTGTPQPQPPSESTEKEPEQDGPAAPADG
STVESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSITEPEGPGGP
NIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAP
LPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEA
PSPGEEQVPPAPLPPASHPPATSTNKRTNLKKPNSERTGHGLRVRFNPLALLLDASLEGE
FDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHC
AASCNSVHLCKQLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMN
KGVAYALWDYEAQNSDELSFHEGDALTILRRKDESETEWWWARLGDREGYVPKNLLGLYP
RIKPRQRTLA
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgatgatattaactgttttcttgagcaacaatgaacagattttaacagaagtt
cctataacaccggaaacaacctgtcgagatgttgtagaattttgcaaggaacctggagaa
ggcagctgccatttagctgaagtgtggaggggaaatgaacgtcccataccctttgatcat
atgatgtacgaacatcttcagaaatggggtccacggagggaagaagtgaaatttttcctt
cgacacgaggactccccaactgagaacagtgaacaaggtggccgtcagacccaagagcaa
cgaactcagagaaatgtaataaatgtacctggagaaaaacgtactgaaaatggggttggg
aatccacgtgttgaacttaccctctcagagctccaagatatggcagctaggcaacagcag
cagattgaaaatcagcagcagatgttggttgccaaggaacagcgtttacattttctaaag
caacaggagcgccgtcagcagcagtctatttctgaaaatgaaaagcttcagaaattgaaa
gaacgagttgaagcccaggagaacaagctgaagaaaattcgtgcaatgagaggacaagtc
gactacagcaaaatcatgaacggcaatctgtctgctgaaatagaaaggttcagtgccatg
ttccaggaaaagaagcaggaagtacagactgcaattttaagggttgatcagcttagtcag
caattggaagatttaaagaaaggaaaactgaatgggttccagtcttacaatggcaaattg
acgggaccagcggcggtggagttaaaaagactgtaccaagaactacagattcgtaaccaa
cttaaccaggaacaaaattcaaaacttcagcagcagaaggaactcttaaataagcgcaac
atggaggtggccatgatggacaagcgaatcagtgaactgcgtgaacgtctctatgggaaa
aaaattcagctgaaccgtgtgaatggcacgtcatcaccacagtcccctctgagcacatcg
ggcagggtcgctgctgtggggccttatatccaggttcccagtgccggaagctttcctgtg
ctgggggaccctataaagccccagtctctcagtattgcctcaaatgctgctcatggaaga
tccaaatccgctaatgatggaaactggccaacattaaaacagaattctagctcttccgtg
aaaccagtgcaggtggccggtgcagactggaaggatccgagcgtggaggggtctgtcaag
cagggcactgtctccagccagcctgtgcccttctcagcactgggacccacggagaagccg
ggcatcgagattggtaaagtgccacctcccatcccgggtgtaggcaagcagctgcctcca
agctatgggacatacccaagtcctacacctctgggtcctgggtcgacaagctccctggaa
aggaggaaggaaggcagcttgcccaggcccagtgcaggcctgccaagtcgacagaggccc
accctgctgcccgccacaggcagcaccccccagccaggctcctcacaacagattcagcag
aggatttccgtaccgccaagtcccacgtacccgccagcgggaccacctgcatttccagct
ggggacagcaagcctgaactcccactgacagtggccattaggcctttcctggctgataaa
gggtcaaggccacagtctcccaggaaaggaccccagacagtgaattcaagttccatatac
tccatgtacctccagcaagccacaccacctaagaattaccagccggcagcacacagcgcc
ttaaataagtcagttaaagcagtgtatggtaagcccgttttaccttcgggttcaacctct
ccatcgccgctgccgtttcttcacgggtcactgtccacgggcacaccacagcctcagcca
ccttcagaaagtactgagaaagagcctgagcaggatggccccgccgcccccgcagatggc
agcaccgtggagagcctgccacggccactcagccccaccaagctcacgcccatcgtgcat
tcgccactgcgctaccagagtgatgcagacctggaggccctccgcaggaagctggccaac
gcgccccggcccctgaaaaagcgcagctccatcacagagcccgagggccccggcgggccc
aacatccagaagctgctgtaccagcgcttcaacaccctggccggtggcatggagggcacc
cctttctaccagcccagcccctcccaggacttcatgggcaccttggccgatgtggacaat
ggaaacaccaatgccaatggaaacctggaagagctcccccctgcccagcccacagcccca
ctccccgctgagcctgccccgtcatcagatgccaatgataatgagttaccttcccccgaa
ccagaggagctcatctgtccccaaaccacccaccaaactgccgagccggcagaggacaat
aacaacaacgtggccacggtccccaccacggagcagatcccgagtcctgtggctgaggcc
ccatctccaggggaagagcaggtccctccagcacctcttccccctgccagccaccctcct
gccacctccacgaacaagcggaccaacttgaagaagcccaactcggagcggacggggcac
gggctgagagtccggtttaaccccctggcactgctcctagacgcgtctctggaaggagag
ttcgatctggtgcagaggatcatctatgaggtggaagatcccagcaagcccaacgacgaa
gggatcaccccactgcacaacgccgtctgcgccggccaccatcacatcgtgaagttcctg
ctggattttggtgtcaacgtgaatgctgctgatagtgatggatggacgccgctgcactgc
gctgcctcttgtaacagcgttcacctctgcaaacagctggtggagagtggtgccgccatt
tttgcctcaaccataagcgacattgaaactgctgcagacaagtgtgaggagatggaggaa
ggctacatccagtgctcccagtttctatatggggtgcaggaaaagctgggtgtgatgaac
aaaggtgtggcgtatgctctgtgggactacgaggcccagaacagtgacgagctgtccttc
cacgaaggggacgccctcaccatcctgaggcgcaaggacgaaagcgagactgagtggtgg
tgggctcgccttggagaccgggagggctatgtgcccaaaaacctgctggggctgtatcca
cggatcaaaccccgacagcgaacactcgcctga

DBGET integrated database retrieval system