KEGG   Homo sapiens (human): 23370Help
Entry
23370             CDS       T01001                                 

Gene name
ARHGEF18, P114-RhoGEF, RP78
Definition
(RefSeq) Rho/Rac guanine nucleotide exchange factor 18
  KO
K21066  A-kinase anchor protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    23370 (ARHGEF18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23370 (ARHGEF18)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    23370 (ARHGEF18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH_16 RhoGEF PH
Motif
Other DBs
NCBI-GeneID: 23370
NCBI-ProteinID: NP_001124427
OMIM: 616432
HGNC: 17090
Ensembl: ENSG00000104880
Vega: OTTHUMG00000177342
Pharos: Q6ZSZ5(Tbio)
UniProt: Q6ZSZ5 A0A3B3IPE9
Position
19p13.2
AA seq 1119 aa AA seqDB search
MGNAHSKSGDRHSALPGRPELSFYGSFPRKWSENVFLDNELLTSKILSVLRPQSERGFRA
GDLRYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPA
GPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESIFVEDPYTASLRSEIESDGH
EFEAESWSLAVDAAYAKKQKREVVKRQDVLYELMQTEVHHVRTLKIMLKVYSRALQEELQ
FSSKAIGRLFPCADDLLETHSHFLARLKERRQESLEEGSDRNYVIQKIGDLLVQQFSGEN
GERMKEKYGVFCSGHNEAVSHYKLLLQQNKKFQNLIKKIGNFSIVRRLGVQECILLVTQR
ITKYPVLVERIIQNTEAGTEDYEDLTQALNLIKDIISQVDAKVSECEKGQRLREIAGKMD
LKSSSKLKNGLTFRKEDMLQRQLHLEGMLCWKTTSGRLKDILAILLTDVLLLLQEKDQKY
VFASVDSKPPVISLQKLIVREVANEEKAMFLISASLQGPEMYEIYTSSKEDRNAWMAHIQ
RAVESCPDEEEGPFSLPEEERKVVEARATRLRDFQERLSMKDQLIAQSLLEKQQIYLEMA
EMGGLEDLPQPRGLFRGGDPSETLQGELILKSAMSEIEGIQSLICRQLGSANGQAEDGGS
STGPPRRAETFAGYDCTNSPTKNGSFKKKVSSTDPRPRDWRGPPNSPDLKLSDSDIPGSS
EESPQVVEAPGTESDPRLPTVLESELVQRIQTLSQLLLNLQAVIAHQDSYVETQRAAIQE
REKQFRLQSTRGNLLLEQERQRNFEKQREERAALEKLQSQLRHEQQRWERERQWQHQELE
RAGARLQEREGEARQLRERLEQERAELERQRQAYQHDLERLREAQRAVERERERLELLRR
LKKQNTAPGALPPDTLAEAQPPSHPPSFNGEGLEGPRVSMLPSGVGPEYAERPEVARRDS
APTENRLAKSDVPIQLLSATNQFQRQAAVQQQIPTKLAASTKGGKDKGGKSRGSQRWESS
ASFDLKQQLLLNKLMGKDESTSRNRRSLSPILPGRHSPAPPPDPGFPAPSPPPADSPSEG
FSLKAGGTALLPGPPAPSPLPATPLSAKEDASKEDVIFF
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgcgcactccaaaagcggggacaggcacagcgcgctccccggccgccccgag
ctgtctttttacggctctttccccaggaaatggagcgagaacgtcttcttggataacgag
ctgctgacctccaagatcctgtctgtgctgcggccgcagtcggagcggggcttccgcgcc
ggggacctccgctacccgacccactttctcagcaccaactctgtccttgcctctgtcaca
gcctcgctcaaggagcacccccggggcaccctcctgtccgatggcagcccggccctgtcc
aggaatgtcggtatgacggtctctcagaaagggggtccccagccaacaccgagcccggct
ggccctgggacgcaactcggaccaatcacaggagagatggatgaagccgattctgcgttt
ttaaaatttaagcagacagctgatgactctctgtcccttacatctccaaacaccgagtcc
atttttgtagaagatccctacaccgcctcgctgaggagtgagattgagtcagacggccac
gagtttgaagctgagtcctggagcctcgccgtggatgcagcctacgccaagaagcaaaag
agggaggtggtgaaaagacaagatgtcctttatgagctgatgcagacagaggtgcaccac
gtgcggacgctcaagatcatgctgaaggtgtactccagggccctgcaggaggagctgcag
ttcagcagcaaggccattggccgcctcttcccatgcgctgacgacctgctggagacgcac
agccacttcctcgctcggctcaaggagcgccgccaggagtccctggaggagggcagtgac
cggaattatgtcatccagaaaatcggcgacctcctggttcagcagttttcaggtgaaaat
ggggagagaatgaaagaaaagtacggtgtgttttgtagtggccacaatgaagctgttagt
cattacaagttgctgcttcagcaaaacaagaaatttcaaaacttgatcaagaaaattggc
aacttctccatcgtgcggcggcttggcgtgcaggagtgcattctcctggttacacaacgc
ataaccaaatacccagtgctggtggagcgcatcatccagaacacggaagctggcactgag
gactatgaagacctgacccaggccttgaacctcatcaaagatatcatctcacaagtggac
gccaaggtcagtgagtgtgagaagggccagcgcctcagggagatcgcagggaagatggac
ctgaagtcttccagcaaactcaagaacgggctcaccttccgcaaggaagacatgcttcag
cggcagctccacctggagggcatgctatgctggaagaccacatcagggcgcttgaaagat
atcctggctatcctgctgaccgacgtacttttgctgctacaagaaaaagatcagaaatac
gtctttgcttctgtggactcaaagccacccgtcatctcgttacaaaagctcatcgtgagg
gaagtggccaacgaggagaaagcgatgtttctgatcagcgcctccttgcaagggccggag
atgtatgaaatctacacgagctccaaagaggacaggaacgcctggatggcccacatccaa
agggctgtggagagctgccctgacgaggaggaggggcccttcagcctgcccgaagaggaa
aggaaggtggtcgaggcccgcgccacgagactccgggactttcaagagcggttgagcatg
aaagaccagctgatcgcacagagcctcctagagaaacagcagatctacctggagatggcc
gagatgggcggcctcgaagacctgccccagccccgaggcctattccgtggaggggaccca
tccgagaccctgcagggggagctaattctcaagtcggccatgagcgagatcgagggcatc
cagagcctgatctgcaggcagctgggcagcgccaacggccaggcggaagacggaggcagc
tccacaggcccgcccaggagggctgagaccttcgcgggctacgactgcacaaacagcccc
accaagaatggcagtttcaagaagaaagtcagcagcactgaccccaggccccgagactgg
cgaggccccccaaacagcccggacttgaagctcagtgacagtgacattcctgggagctct
gaggaatcgccgcaggtggtggaggcgccaggcacggaatccgatccccgtctgcccacc
gtcctggagtcggagcttgtccagcggatccagacactgtcccagctgctcctgaacctt
caggcggtaatcgcccaccaggacagctatgtggagacgcagcgggctgccatccaggag
cgggagaagcagttccggctgcagtcgacgcgtgggaacctgctgctggagcaggagcgg
caacgcaacttcgagaagcagcgggaggagcgcgcggccctggagaagctgcagagccag
ctgcggcacgagcagcagcgctgggagcgcgagcgccagtggcagcaccaggagctggag
cgtgcgggcgcgcggctgcaggagcgcgagggcgaggcgcggcagctacgcgagcggctg
gagcaggagcgggccgagctggagcgccagcgccaggcctaccagcacgacctggagcgg
ctgcgcgaggcccagcgtgccgtggagcgcgagcgggagcgcctggagctgctgcgccgc
ctcaagaagcagaacaccgcgccaggcgcgctgccgcccgacacactggccgaggcccag
cccccaagccaccctcccagcttcaacggggaagggctggagggccctcgtgtgagcatg
ctgccatccggcgtggggccagagtacgcagagcgccccgaggtggctcgccgggacagc
gcccccaccgagaaccggctggccaagagcgatgtgcccatccagctgctcagcgccacc
aaccagttccagaggcaggcggccgtgcagcagcagatccccaccaagctggcggcctcc
accaagggtggcaaggacaagggcggcaagagcaggggctctcagcgctgggagagctca
gcgtccttcgacctgaagcagcagctgctgctcaacaagctcatggggaaagatgagagc
acctcacggaaccgccgctcgctgagccctatcctgcccggcagacacagtcctgcgccc
ccaccagaccctggcttccccgccccgagcccaccgccagctgacagcccctccgagggc
ttctctctcaaggccgggggcacagccctcctgcccgggcccccagctccctcgccactg
ccggccacaccactcagcgccaaggaggacgccagcaaagaagacgtcatcttcttctaa

DBGET integrated database retrieval system