KEGG   Homo sapiens (human): 23380Help
Entry
23380             CDS       T01001                                 

Gene name
SRGAP2, ARHGAP34, FNBP2, SRGAP2A, SRGAP3
Definition
(RefSeq) SLIT-ROBO Rho GTPase activating protein 2
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    23380 (SRGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23380 (SRGAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    23380 (SRGAP2)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    23380 (SRGAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP FCH SH3_1 SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 23380
NCBI-ProteinID: NP_056141
OMIM: 606524
HGNC: 19751
Ensembl: ENSG00000266028
Vega: OTTHUMG00000184381
Pharos: O75044(Tbio)
UniProt: O75044 B4DFE5
Structure
PDB: 

Position
1q32.1
AA seq 1071 aa AA seqDB search
MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYT
ENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQ
PVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGE
SQRTDCSLARRSSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKN
AFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALH
IRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSC
QAHVNELIKTIIIQHENIFPSPRELEGPVYSRGGSMEDYCDSPHGETTSVEDSTQDVTAE
HHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQ
YIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKR
PESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS
LNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEVIAQDIEATMNSALNELREL
ERQSSVKHTPDVVLDTLEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIAC
AFRPVKSVKMAAPVKPPATRPKPTVFPKTNATSPGVNSSTSPQSTDKSCTV
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctccagccaaattcaaaaaggataaggagatcatagcagagtacgatactcag
gtcaaagagatccgtgctcagctcacagagcagatgaaatgcctggaccagcagtgtgag
cttcgggtgcaactgttgcaggacctccaggacttcttccgaaagaaggcagagattgag
atggactactcccgcaacctggagaagctggcagaacgcttcctggccaagacacgcagc
accaaggaccagcaattcaagaaggatcagaatgttctctctccagtcaactgctggaat
ctcctcttaaaccaggtgaagcgggaaagcagggaccataccaccctgagtgacatctac
ctgaataatatcattcctcgatttgtacaagtcagcgaggactcaggaagactctttaaa
aagagtaaagaagtcggccagcagctccaagatgatttgatgaaggtcctgaacgagctc
tactcggtgatgaagacatatcacatgtacaatgccgacagcatcagtgctcagagcaaa
ctaaaggaggcggagaagcaggaggagaagcaaattggtaaatcggtaaagcaggaggac
cggcagaccccacgctcccctgactccacggccaacgttcgcattgaggagaaacatgtc
cggaggagctcagtgaagaagattgagaagatgaaggagaagcgtcaagccaagtacacg
gagaataagctgaaggccatcaaagcccggaatgagtacttgctggctttggaggcaacc
aatgcatctgtcttcaagtactacatccatgacctatctgaccttattgatcagtgttgt
gacttaggctaccatgcaagtctgaaccgggctctacgcaccttcctctctgctgagtta
aacctggaacagtcgaagcatgagggtctggatgccatcgagaatgcagtagaaaacctg
gatgccaccagtgacaagcagcgcctcatggagatgtacaacaacgtcttctgcccccct
atgaagtttgagtttcagccccacatgggggatatggcttcccagctctgtgcccagcag
cctgtccagagtgagctggtacagagatgccaacaactgcagtctcgcttatccactcta
aagattgaaaacgaagaggtaaagaagacaatggaggccaccctgcaaaccatccaggac
attgtgactgtcgaggactttgatgtgtctgactgcttccagtacagcaactccatggag
tccgtcaagtccacggtctctgaaaccttcatgagcaagcccagcattgctaagaggaga
gccaaccagcaagagacagagcagttttatttcacaaaaatgaaagagtacctggagggc
aggaacctcatcaccaagttacaagccaagcatgaccttctgcagaaaaccctgggagaa
agtcagcggacagattgcagtctagccaggcgcagctcaactgtgaggaaacaggactcc
agccaggcaattcctctggtggtggaaagctgtatccggtttatcagcagacacggacta
cagcatgaaggaattttccgggtgtcaggatcccaggtggaagtgaatgacatcaaaaat
gcctttgagagaggagaggaccccctggctggggaccagaacgaccatgacatggattcc
atagctggtgtcctgaagctttacttccgggggctggaacaccctctcttccccaaggac
atctttcatgacctgatggcctgcgtcacaatggacaacctgcaggagagagctctgcac
atccggaaagtcctcctagtcctgcccaaaaccactctgattatcatgagatacctcttt
gccttcctcaatcatttatcacagttcagtgaagagaacatgatggacccctacaacctc
gccatctgcttcgggccctcgctaatgtcagtgccagagggccacgaccaggtgtcctgc
caagcccacgtgaatgagctgatcaaaaccatcatcatccagcatgagaacatcttccca
agccccagggagctggagggccctgtctacagcagaggaggaagcatggaggattactgt
gatagccctcatggagagactacctcggttgaagactcaacccaggatgtgaccgcagag
caccacacgagcgatgacgaatgtgagcccatcgaggccattgccaagtttgactacgtg
ggccggacagcccgagagctatcctttaagaagggagcatccctgctgctttaccagcgg
gcttccgacgactggtgggaaggccggcacaatggcatcgacggactcatcccccatcag
tacatcgtggtccaagacaccgaggacggtgtcgtggagaggtccagccccaagtctgag
attgaggtcatttctgagccacctgaagaaaaggtgacagccagagcgggggccagctgt
cccagtgggggtcatgtagccgatatttatcttgcaaacatcaacaagcaaaggaagcgt
ccagaatctgggagcatccggaaaacttttcggagtgacagccatgggctgagcagttcc
ctgactgactcctcctccccaggggtgggggctagctgccgcccatcctcccagcccatc
atgagccagagcctccccaaagaagggccagataagtgttccatcagtgggcacgggagc
ctcaactccatcagccgccactcatccctgaagaatcggctggatagtccacagatccgg
aagactgccacagcgggaaggtcaaaaagcttcaataaccatcggcccatggaccctgag
gtcattgctcaggatattgaggcaacaatgaactcggccctgaatgagctacgggaacta
gaacggcagagcagtgtcaaacacacccctgacgtggttctggacaccttggagcccctc
aaaacctccccagtggtggcccccacgtcagagccctccagccctctgcacacccagctc
ctcaaggaccccgagcccgccttccagcgcagcgccagtactgctggggacatcgcctgc
gccttccggcctgtcaagtctgtcaagatggctgccccggtcaaaccaccagccacacgg
cccaagcccactgtcttccccaaaacaaatgccactagccctggtgtcaactcatcaact
tccccacagtctactgacaagtcttgtactgtctga

DBGET integrated database retrieval system