KEGG   Homo sapiens (human): 2339Help
Entry
2339              CDS       T01001                                 

Gene name
FNTA, FPTA, PGGT1A, PTAR2
Definition
(RefSeq) farnesyltransferase, CAAX box, alpha
  KO
K05955  protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha [EC:2.5.1.58 2.5.1.59]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
Drug target
Lonafarnib: D04768
Tipifarnib: D03720
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    2339 (FNTA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    2339 (FNTA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.58  protein farnesyltransferase
     2339 (FNTA)
    2.5.1.59  protein geranylgeranyltransferase type I
     2339 (FNTA)
Prenyltransferases [BR:hsa01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   2339 (FNTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPTA
Motif
Other DBs
NCBI-GeneID: 2339
NCBI-ProteinID: NP_002018
OMIM: 134635
HGNC: 3782
Ensembl: ENSG00000168522
Vega: OTTHUMG00000165279
Pharos: P49354(Tbio)
UniProt: P49354
Structure
PDB: 

Position
8p11.21
AA seq 379 aa AA seqDB search
MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDS
PSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSTENDSPTNVQQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccgagggggtcggggaggctgcgcaagggggcgagcccgggcagccggcg
caacccccgccccagccgcacccaccgccgccccagcagcagcacaaggaagagatggcg
gccgaggctggggaagccgtggcgtcccccatggacgacgggtttgtgagcctggactcg
ccctcctatgtcctgtacagggacagagcagaatgggctgatatagatccggtgccgcag
aatgatggccccaatcccgtggtccagatcatttatagtgacaaatttagagatgtttat
gattacttccgagctgtcctgcagcgtgatgaaagaagtgaacgagcttttaagctaacc
cgggatgctattgagttaaatgcagccaattatacagtgtggcatttccggagagttctt
ttgaagtcacttcagaaggatctacatgaggaaatgaactacatcactgcaataattgag
gagcagcccaaaaactatcaagtttggcatcataggcgagtattagtggaatggctaaga
gatccatctcaggagcttgaatttattgctgatattcttaatcaggatgcaaagaattat
catgcctggcagcatcgacaatgggttattcaggaatttaaactttgggataatgagctg
cagtatgtggaccaacttctgaaagaggatgtgagaaataactctgtctggaaccaaaga
tacttcgttatttctaacaccactggctacaatgatcgtgctgtattggagagagaagtc
caatacactctggaaatgattaaactagtaccacataatgaaagtgcatggaactatttg
aaagggattttgcaggatcgtggtctttccaaatatcctaatctgttaaatcaattactt
gatttacaaccaagtcatagttccccctacctaattgcctttcttgtggatatctatgaa
gacatgctagaaaatcagtgtgacaataaggaagacattcttaataaagcattagagtta
tgtgaaatcctagctaaagaaaaggacactataagaaaggaatattggagatacattgga
agatcccttcaaagcaaacacagcacagaaaatgactcaccaacaaatgtacagcaataa

DBGET integrated database retrieval system