KEGG   Homo sapiens (human): 23399
Entry
23399             CDS       T01001                                 
Symbol
CTDNEP1, DULLARD, HSA011916, NET56
Name
(RefSeq) CTD nuclear envelope phosphatase 1
  KO
K17617  CTD nuclear envelope phosphatase 1 [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23399 (CTDNEP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     23399 (CTDNEP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   23399 (CTDNEP1)
SSDB
Motif
Pfam: NIF
Other DBs
NCBI-GeneID: 23399
NCBI-ProteinID: NP_001137247
OMIM: 610684
HGNC: 19085
Ensembl: ENSG00000175826
Pharos: O95476(Tbio)
UniProt: O95476
Position
17:complement(7243591..7251978)
AA seq 244 aa
MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVK
RKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEV
VSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLS
SIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQ
HRLW
NT seq 735 nt   +upstreamnt  +downstreamnt
atgatgcggacgcagtgtctgctggggctgcgcacgttcgtggccttcgccgccaagctc
tggagcttcttcatttaccttctgcggaggcagatccgcacggtaattcagtaccaaact
gttcgatatgatatcctccccttatctcctgtgtcccggaatcggctagcccaggtgaag
aggaagatcctggtgctggatctggatgagacacttattcactcccaccatgatggggtc
ctgaggcccacagtccggcctggtacgcctcctgacttcatcctcaaggtggtaatagac
aaacatcctgtccggttttttgtacataagaggccccatgtggatttcttcctggaagtg
gtgagccagtggtacgagctggtggtgtttacagcaagcatggagatctatggctctgct
gtggcagataaactggacaatagcagaagcattcttaagaggagatattacagacagcac
tgcactttggagttgggcagctacatcaaggacctctctgtggtccacagtgacctctcc
agcattgtgatcctggataactccccaggggcttacaggagccatccagacaatgccatc
cccatcaaatcctggttcagtgaccccagcgacacagcccttctcaacctgctcccaatg
ctggatgccctcaggttcaccgctgatgttcgttccgtgctgagccgaaaccttcaccaa
catcggctctggtga

DBGET integrated database retrieval system