KEGG   Homo sapiens (human): 23403Help
Entry
23403             CDS       T01001                                 

Gene name
FBXO46, 20D7-FC4, FBXO34L, Fbx46
Definition
(RefSeq) F-box protein 46
  KO
K10320  F-box protein 46
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     23403 (FBXO46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box BTK CHORD
Motif
Other DBs
NCBI-GeneID: 23403
NCBI-ProteinID: NP_001073938
OMIM: 609117
HGNC: 25069
Ensembl: ENSG00000177051
Vega: OTTHUMG00000182132
Pharos: Q6PJ61(Tdark)
UniProt: Q6PJ61
Position
19q13.32
AA seq 603 aa AA seqDB search
MDRGSLLPFQLWCPRPFGTYSQNQPRPPSAALKPSACPEPGGGAEPDHGPAHSENTPPAL
ATEVPASQPAPLLSAAAAGDEGRVLLDTWYVIKPGNTKEKVAFFVAHQCGGGSRASSMKV
KGHWGSDSSKAKRRRRCLDPTKAPPDPGGREGPPAAEEGPASAGEDVDLLSVAEMVALVE
QRAALALQSYPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDS
PPTKGLRKEERPGPGPGEVRIAFRISNGREPRAPDSGLPSGGGGRPGCAYPGSPGPGARA
KDKITCDLYQLISPSRDALPSNVEFLLARADEASEGDSPAPARPEDTPPAPPPPPARDCG
ASGFHVDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRGPDGPP
EPPPADSPATAPGPDDAEGTADTSLCRLYRHVSHDFLEIRFKIQRLLEPRQYMLLLPEHV
LVKIFSFLPTRALAALKCTCHHFKGIIEAFGVRATDSRWSRDPLYRDDPCKQCRKRYEKG
DVSLCRWHPKPYHHDLPYGRSYWMCCRRADRETPGCRLGLHDNNWVLPCNGPGGGRAGRE
EGR
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgggagcctcctgcccttccagctatggtgcccccggccctttggcacctac
tcacagaaccagccacgcccgccttctgcggccctcaagccatcagcctgccctgagcct
ggtggcggggccgagccagaccatgggcctgcccactcagagaacacaccacccgccttg
gccactgaggtccctgcctcccagccggctccgctcctctcagcagcagctgctggtgat
gagggtcgagtcctcctggacacgtggtatgtcatcaagcccgggaatacaaaggagaag
gtggccttctttgtggcccaccagtgtggtgggggcagccgggccagctccatgaaggtc
aaggggcactggggcagcgatagctccaaggccaagcggcggaggcgctgtcttgacccc
accaaggctcctcctgacccagggggccgggagggcccccctgctgctgaggagggcccc
gcctcagccggtgaggacgtggacctgctctctgtggccgagatggtggccctggtggaa
cagcgggcagccctggccctgcagagctacccacgaccgaccaccccagcgcctgtagtc
tttgtgtccgccgagcaaggtggaccggccaagggggtgggatctgaacggcggtccggt
ggtggggactgcagccgtgtagccgaggccgtggcccactttgaagcgcagagggacagc
cctcccaccaagggcctccgcaaggaagagcggcccgggccaggccctggggaggtgcgc
atcgccttccgcatctccaacggccgggagccccgtgcaccagacagcggcctgcccagt
gggggcgggggcaggcctggttgtgcctaccctggcagcccaggtcctggggcccgagcc
aaggacaagatcacatgtgacttataccagctcatcagcccctcgcgggatgccctcccc
agcaacgtggagttcctgctggccagggcggatgaggccagtgagggtgacagcccggca
cccgccaggcctgaggacactcccccggcgccccctccgccccctgcccgggactgcgga
gcgtcaggcttccacgtggacgtggtggtgacgggcgtggtagatgagtgcatcttcttt
ggcaaggacggcaccaagaacgtgaaggaggagactgtgtgcctgacggtcagcccggag
gaaccgccgcctccgggccagctcttctttctccagaaccgcgggccggacgggcccccg
gagccacccccggccgactccccggccactgcgcccggcccagacgatgccgagggcacg
gcggacacctccctgtgccgcttgtaccggcacgtgtcgcacgacttcctagagatccgc
ttcaagattcagcggctgctggagccgcgacagtacatgctgctgctgcccgagcacgtg
ctggtcaagatcttcagcttcctgcccacgcgcgcgctggccgccctcaagtgcacctgc
caccacttcaagggcatcatcgaggcgtttggcgtgcgggccacagactcgcgctggagc
cgagacccgctctaccgcgatgatccgtgcaaacagtgccgcaagagatacgagaagggc
gacgtgtcgctctgccgctggcaccccaagccctaccaccatgacctgccttacggacgt
tcctactggatgtgctgccgtcgagccgaccgcgagactcccggctgccgcctgggcctc
cacgataacaactgggtgctgccctgcaatgggccaggcgggggccgggccggccgggag
gaggggaggtga

DBGET integrated database retrieval system