KEGG   Homo sapiens (human): 23406
Entry
23406             CDS       T01001                                 

Gene name
COTL1, CLP
Definition
(RefSeq) coactosin like F-actin binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cofilin_ADF Sin3a_C
Other DBs
NCBI-GeneID: 23406
NCBI-ProteinID: NP_066972
OMIM: 606748
HGNC: 18304
Ensembl: ENSG00000103187
Vega: OTTHUMG00000137634
Pharos: Q14019(Tbio)
UniProt: Q14019 A0A384MTY2
Structure
PDB: 

Position
16q24.1
AA seq 142 aa
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFA
FVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
EEDFIKSELKKAGGANYDAQTE
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccaccaagatcgacaaagaggcttgccgggcggcgtacaacctggtgcgcgacgac
ggctcggccgtcatctgggtgacttttaaatatgacggctccaccatcgtccccggcgag
cagggagcggagtaccagcacttcatccagcagtgcacagatgacgtccggttgtttgcc
ttcgtgcgcttcaccaccggggatgccatgagcaagaggtccaagtttgccctcatcacg
tggatcggtgagaacgtcagcgggctgcagcgcgccaaaaccgggacggacaagaccctg
gtgaaggaggtcgtacagaatttcgctaaggagtttgtgatcagtgatcggaaggagctg
gaggaagatttcatcaagagcgagctgaagaaggcggggggagccaattacgacgcccag
acggagtaa

DBGET integrated database retrieval system