KEGG   Homo sapiens (human): 23409Help
Entry
23409             CDS       T01001                                 

Gene name
SIRT4, SIR2L4
Definition
(RefSeq) sirtuin 4
  KO
K11414  NAD-dependent deacetylase sirtuin 4 [EC:3.5.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23409 (SIRT4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     23409 (SIRT4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     23409 (SIRT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2
Motif
Other DBs
NCBI-GeneID: 23409
NCBI-ProteinID: NP_036372
OMIM: 604482
HGNC: 14932
Ensembl: ENSG00000089163
Vega: OTTHUMG00000169028
Pharos: Q9Y6E7(Tbio)
UniProt: Q9Y6E7
Position
12q24.23-q24.31
AA seq 314 aa AA seqDB search
MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVM
TGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQ
PNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGV
LQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNP
DKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKL
NSRCGELLPLIDPC
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagctttgcgttgactttcaggtcagcaaaaggccgttggatcgcaaacccc
agccagccgtgctcgaaagcctccattgggttatttgtgccagcaagtcctcctctggac
cctgagaaggtcaaagagttacagcgcttcatcaccctttccaagagactccttgtgatg
actggggcaggaatctccaccgaatcggggataccagactacaggtcagaaaaagtgggg
ctttatgcccgcactgaccgcaggcccatccagcatggtgattttgtccggagtgcccca
atccgccagcggtactgggcgagaaacttcgtaggctggcctcaattctcctcccaccag
cctaaccctgcacactgggctttgagcacctgggagaaactcggaaagctgtactggttg
gtgacccaaaatgtggatgctttgcacaccaaggcggggagtcggcgcctgacagagctc
cacggatgcatggacagggtcctgtgcttggattgtggggaacagactccccggggggtg
ctgcaagagcgtttccaagtcctgaaccccacctggagtgctgaggcccatggcctggct
cctgatggtgacgtctttctctcagaggagcaagtccggagctttcaggtcccaacctgc
gttcaatgtggaggccatctgaaaccagatgtcgttttcttcggggacacagtgaaccct
gacaaggttgattttgtgcacaagcgtgtaaaagaagccgactccctcttggtggtggga
tcatccttgcaggtatactctggttacaggtttatcctcactgcctgggagaagaagctc
ccgattgcaatactgaacattgggcccacacggtcggatgacttggcgtgtctgaaactg
aattctcgttgtggagagttgctgcctttgatagacccatgctga

DBGET integrated database retrieval system