KEGG   Homo sapiens (human): 23412Help
Entry
23412             CDS       T01001                                 

Gene name
COMMD3, BUP, C10orf8
Definition
(RefSeq) COMM domain containing 3
  KO
K22559  COMM domain containing 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23412 (COMMD3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    23412 (COMMD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COMM_domain
Motif
Other DBs
NCBI-GeneID: 23412
NCBI-ProteinID: NP_036203
OMIM: 616700
HGNC: 23332
Ensembl: ENSG00000148444
Vega: OTTHUMG00000017806
Pharos: Q9UBI1(Tbio)
UniProt: Q9UBI1
Position
10p12.2
AA seq 195 aa AA seqDB search
MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLK
HCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGR
SLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVG
KLKDASKSLERATQL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcggagtctgtgcagaaaggcttccagatgctggcggatccccgctccttc
gactccaacgccttcacgcttctcctccgggcggcattccagagtctgctggacgcccag
gcggacgaggccgtgttagatcatccagacttgaaacatatcgacccagtggttttaaaa
cattgtcatgcagcagctgcaacttacatactagaggcaggaaagcaccgagctgacaag
tcaactctaagcacttatctagaagactgtaaatttgacagagagcgaatagaactgttt
tgcacggaatatcagaataataagaattccctagaaatcctactgggaagtataggcaga
tctctccctcatataacggatgtttcttggcgcttggaatatcagataaagaccaatcaa
cttcataggatgtacagacctgcatatttggtgaccttaagtgtacagaacactgattcc
ccatcctatccagagattagttttagttgcagcatggaacaattacaggacttggtgggg
aaacttaaagatgcttcgaaaagcctggaaagagcaactcagttgtaa

DBGET integrated database retrieval system