KEGG   Homo sapiens (human): 23416Help
Entry
23416             CDS       T01001                                 

Gene name
KCNH3, BEC1, ELK2, Kv12.2
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 3
  KO
K04906  potassium voltage-gated channel Eag-related subfamily H member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    23416 (KCNH3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   23416 (KCNH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PAS_9 Ion_trans_2 cNMP_binding PAS_4 PAS_3 PAS UBM S6PP SlyX
Motif
Other DBs
NCBI-GeneID: 23416
NCBI-ProteinID: NP_036416
OMIM: 604527
HGNC: 6252
Ensembl: ENSG00000135519
Vega: OTTHUMG00000169517
Pharos: Q9ULD8(Tclin)
UniProt: Q9ULD8
Position
12q13.12
AA seq 1083 aa AA seqDB search
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISETKNRGGPDRWKETGGGRRRYGRARSKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACVWFYIGQREIESSESELPEIGWLQELARRLETPYYLVGRRPAGG
NSSGQSDNCSSSSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKI
FSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLE
YFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRP
AFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKANA
DVKGLTYCVLQCLQLAGLHDSLALYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSG
DNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLG
GRGRPGRAGALKAEAGPSAPPRALEGLRLPPMPWNVPPDLSPRVVDGIEDGCGSDQPKFS
FRVGQSGPECSSSPSPGPESGLLTVPHGPSEARNTDTLDKLRQAVTELSEQVLQMREGLQ
SLRQAVQLVLAPHREGPCPRASGEGPCPASTSGLLQPLCVDTGASSYCLQPPAGSVLSGT
WPHPRPGPPPLMAPWPWGPPASQSSPWPRATAFWTSTSDSEPPASGDLCSEPSTPASPPP
SEEGARTGPAEPVSQAEATSTGEPPPGSGGLALPWDPHSLEMVLIGCHGSGTVQWTQEEG
TGV
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgccggccatgcggggcctcctggcgccgcagaacaccttcctggacaccatcgctacg
cgcttcgacggcacgcacagtaacttcgtgctgggcaacgcccaggtggcggggctcttc
cccgtggtctactgctctgatggcttctgtgacctcacgggcttctcccgggctgaggtc
atgcagcggggctgtgcctgctccttcctttatgggccagacaccagtgagctcgtccgc
caacagatccgcaaggccctggacgagcacaaggagttcaaggctgagctgatcctgtac
cggaagagcgggctcccgttctggtgtctcctggatgtgatacccataaagaatgagaaa
ggggaggtggctctcttcctagtctctcacaaggacatcagcgaaaccaagaaccgaggg
ggccccgacagatggaaggagacaggtggtggccggcgccgatatggccgggcacgatcc
aaaggcttcaatgccaaccggcggcggagccgggccgtgctctaccacctgtccgggcac
ctgcagaagcagcccaagggcaagcacaagctcaataagggggtgtttggggagaaacca
aacttgcctgagtacaaagtagccgccatccggaagtcgcccttcatcctgttgcactgt
ggggcactgagagccacctgggatggcttcatcctgctcgccacactctatgtggctgtc
actgtgccctacagcgtgtgtgtgagcacagcacgggagcccagtgccgcccgcggcccg
cccagcgtctgtgacctggccgtggaggtcctcttcatccttgacattgtgctgaatttc
cgtaccacattcgtgtccaagtcgggccaggtggtgtttgccccaaagtccatttgcctc
cactacgtcaccacctggttcctgctggatgtcatcgcagcgctgccctttgacctgcta
catgccttcaaggtcaacgtgtacttcggggcccatctgctgaagacggtgcgcctgctg
cgcctgctgcgcctgcttccgcggctggaccggtactcgcagtacagcgccgtggtgctg
acactgctcatggccgtgttcgccctgctcgcgcactgggtcgcctgcgtctggttttac
attggccagcgggagatcgagagcagcgaatccgagctgcctgagattggctggctgcag
gagctggcccgccgactggagactccctactacctggtgggccggaggccagctggaggg
aacagctccggccagagtgacaactgcagcagcagcagcgaggccaacgggacggggctg
gagctgctgggcggcccgtcgctgcgcagcgcctacatcacctccctctacttcgcactc
agcagcctcaccagcgtgggcttcggcaacgtgtccgccaacacggacaccgagaagatc
ttctccatctgcaccatgctcatcggcgccctgatgcacgcggtggtgtttgggaacgtg
acggccatcatccagcgcatgtacgcccgccgctttctgtaccacagccgcacgcgcgac
ctgcgcgactacatccgcatccaccgtatccccaagcccctcaagcagcgcatgctggag
tacttccaggccacctgggcggtgaacaatggcatcgacaccaccgagctgctgcagagc
ctccctgacgagctgcgcgcagacatcgccatgcacctgcacaaggaggtcctgcagctg
ccactgtttgaggcggccagccgcggctgcctgcgggcactgtctctggccctgcggccc
gccttctgcacgccgggcgagtacctcatccaccaaggcgatgccctgcaggccctctac
tttgtctgctctggctccatggaggtgctcaagggtggcaccgtgctcgccatcctaggg
aagggcgacctgatcggctgtgagctgccccggcgggagcaggtggtaaaggccaatgcc
gacgtgaaggggctgacgtactgcgtcctgcagtgtctgcagctggctggcctgcacgac
agccttgcgctgtaccccgagtttgccccgcgcttcagtcgtggcctccgaggggagctc
agctacaacctgggtgctgggggaggctctgcagaggtggacaccagctccctgagcggc
gacaatacccttatgtccacgctggaggagaaggagacagatggggagcagggccccacg
gtctccccagccccagctgatgagccctccagccccctgctgtcccctggctgcacctcc
tcatcctcagctgccaagctgctatccccacgtcgaacagcaccccggcctcgtctaggt
ggcagagggaggccaggcagggcaggggctttgaaggctgaggctggcccctctgctccc
ccacgggccctagaggggctacggctgccccccatgccatggaatgtgcccccagatctg
agccccagggtagtagatggcattgaagacggctgtggctcggaccagcccaagttctct
ttccgcgtgggccagtctggcccggaatgtagcagcagcccctcccctggaccagagagc
ggcctgctcactgttccccatgggcccagcgaggcaaggaacacagacacactggacaag
cttcggcaggcggtgacagagctgtcagagcaggtgctgcagatgcgggaaggactgcag
tcacttcgccaggctgtgcagcttgtcctggcgccccacagggagggtccgtgccctcgg
gcatcgggagaggggccgtgcccagccagcacctccgggcttctgcagcctctgtgtgtg
gacactggggcatcctcctactgcctgcagcccccagctggctctgtcttgagtgggact
tggccccaccctcgtccggggcctcctcccctcatggcaccctggccctggggtccccca
gcgtctcagagctccccctggcctcgagccacagctttctggacctccacctcagactca
gagccccctgcctcaggagacctctgctctgagcccagcacccctgcctcccctcctcct
tctgaggaaggggctaggactgggcccgcagagcctgtgagccaggctgaggctaccagc
actggagagcccccaccagggtcagggggcctggccttgccctgggacccccacagcctg
gagatggtgcttattggctgccatggctctggcacagtccagtggacccaggaagaaggc
acaggggtctga

DBGET integrated database retrieval system