KEGG   Homo sapiens (human): 23420
Entry
23420             CDS       T01001                                 
Symbol
NOMO1, Nomo, PM5
Name
(RefSeq) NODAL modulator 1
  KO
K26500  BOS complex subunit NOMO
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23420 (NOMO1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Multi-pass translocon (MPT) complex
    23420 (NOMO1)
SSDB
Motif
Pfam: NOMO1-like_2nd CarboxypepD_reg NOMO1-like_1st NOMO1-like_7th SdrD_B SpaA EMC7_beta-sandw CarbopepD_reg_2 fn3_3 DUF6795 DUF1416
Other DBs
NCBI-GeneID: 23420
NCBI-ProteinID: NP_055102
OMIM: 609157
HGNC: 30060
Ensembl: ENSG00000103512
UniProt: Q15155
Position
16:14833721..14896157
AA seq 1222 aa
MLVGQGAGPLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGG
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSS
LVTKEDVLGCNVSPVPGFQPQDESLVYLCYTVSREDGSFSFYSLPSGGYTVIPFYRGERI
TFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFP
DTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLK
PQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQTGYMLRCSLSHAI
TLEFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILT
LTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSME
AVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSV
GPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTA
YSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKA
EGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKH
ITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQA
ASDNSGPEDAKRQAKKQKTRRT
NT seq 3669 nt   +upstreamnt  +downstreamnt
atgctggtgggccagggcgcggggccgctggggcccgcggtggtcaccgccgcggtggtg
ctgctgctgagcggcgtggggccggcgcacggctcggaggacatcgtggtgggctgcggt
ggcttcgtcaagtcggacgtggagatcaactactctctcatcgagataaagctgtacacc
aagcatgggactttgaaataccagacagactgtgcccctaataatggttactttatgatc
cctttgtatgataagggggatttcattctgaagattgagcctcccctagggtggagtttt
gagccgacgaccgtggagctccatgtggatggagtcagtgacatctgcacaaagggtggg
gacatcaactttgtcttcactgggttctctgtgaatggcaaggtcctcagcaaagggcag
cccctgggtcctgcgggagttcaggtgtctctgagaaacactgggaccgaagcaaagatc
cagtccacagttacacagcctggcggaaagtttgcattttttaaagttctgcctggagat
tatgaaatcctcgcaactcatccaacctgggcgttgaaagaggcaagcaccacagtgcgt
gtaaccaactccaatgccaatgcggccagtcccctcatagttgctggctacaatgtgtct
ggctctgtccgaagtgatggggagcccatgaaaggcgtgaagtttcttctcttttcttct
ttagtaactaaagaggatgtcctgggctgcaatgtctcaccagtgcctgggttccagccc
caagacgagagtctggtgtatttgtgctacacggtctccagagaagatggctcgttctct
ttctattccttgccaagtgggggctacactgtgattccgttctatcgaggggagaggatt
acctttgatgtggcgccttccagacttgacttcacagtggagcatgacagcttgaaaatc
gagcccgtgttccacgtcatgggattctccgtcaccgggagggtcttgaacggacccgaa
ggagatggtgttccagaagcagtagtcaccctgaataaccaaatcaaagttaaaacaaaa
gctgatggctcattccgccttgagaacataaccacagggacatacaccatccatgctcag
aaagagcacctctactttgaaacggtcaccatcaaaattgcaccgaacacacctcagctg
gctgacattattgcaacagggttcagtgtctgtggtcagatatcaatcattcgcttcccc
gacaccgtcaagcagatgaataaatacaaagttgtcctgtcatctcaagacaaggacaag
tctttggtcaccgtggagacagatgctcatggatcattttgttttaaagcaaaaccaggg
acttacaaagtgcaggtgatggttcctgaggcagaaaccagagcagggctgacgttgaaa
ccccagacatttcctcttactgtgaccaacaggcccatgatggatgtggcctttgtacag
ttcttggcatcagtttctgggaaagtctcttgtttggacacctgtggtgacttgctggtg
actctacagtccctgagccgccagggtgagaagcggagcctccagctctccggcaaggtc
aacgccatgactttcacctttgacaacgtgctccctggaaaatacaaaataagcatcatg
catgaggattggtgctggaagaacaagagcctggaggtggaagtgctggaggatgacatg
tctgcagttgagttcaggcagacgggctacatgctgagatgttccctgtctcacgccatc
actctggaattttatcaggatggaaatgggcgtgagaatgtggggatttataacctctcc
aaaggagtcaaccgattctgcctgtccaagcctggtgtgtacaaagtgacccctcgctcc
tgccaccggtttgagcaagcgttctacacctatgacacgtcttcacctagtatcttgaca
ttgacagccattcgccaccatgtccttggaactatcaccaccgacaaaatgatggatgtc
actgtgactatcaagtcttccatcgacagtgaacccgccttggtcttaggccctctgaag
tctgtgcaggagctgcggagggagcagcagctggctgagatcgaggcccgcaggcaggag
agggagaaaaacggcaatgaggaaggcgaagaaagaatgaccaagcctcccgtgcaggag
atggtagatgagttacaaggccccttctcgtatgatttctcttactgggcgcggtctgga
gagaaaatcactgttacaccgtcatctaaagagctgctcttttatcccccttcaatggaa
gccgttgtcagtggagaaagctgcccagggaagctgatcgagatccatgggaaggcaggc
ctgtttttagaaggccagatccaccccgagttggaaggagtcgagattgtcatcagtgaa
aagggggcaagttcaccgctgatcacagtctttactgatgacaaaggtgcctacagtgtt
ggccccctgcacagtgacctggagtacacggtgacctcacagaaggagggctatgttctg
actgcggtggaaggaaccatcggagacttcaaggcctatgccctggcaggcgtaagcttt
gagataaaagctgaggatgaccagcccctcccgggagtcctcttatccctgagcggtggc
ctgtttcgttccaacctcttgacccaggacaacggcattctgacattctcaaacctgagc
cctggccagtattacttcaaacccatgatgaaggagttccggtttgagccatcctcacag
atgatcgaggtgcaggaaggccagaacctgaagatcaccatcacggggtaccgaaccgct
tacagttgctatggcacagtgtcttccttaaacggagagcccgaacaaggggttgccatg
gaagcggtgggccagaacgactgcagcatttacggagaagacaccgtgacagacgaagag
ggcaagttcagattacgtggattgctgccgggatgtgtgtaccacgttcagctcaaggca
gaaggcaacgaccacattgagcgggcgctcccccaccatagggtgattgaggttgggaat
aatgacatcgatgatgtaaacatcatagttttccggcagattaatcaatttgatttaagt
ggaaatgtgatcacttcctctgaataccttcctacattatgggtcaagctttacaaaagc
gaaaacctcgacaatccaatccagacagtttcccttggccagtccctgttcttccatttc
cccccactgctcagagacggcgagaactatgttgtgcttctggactccacactccccaga
tcccagtatgactacatcttgcctcaagtttctttcaccgcagtgggctaccataaacac
atcaccttgatttttaatcccacgaggaagctgcctgaacaggacatcgcacaaggatcc
tacattgccctgccattgacgctgctggttctgctggccggttacaaccatgacaagctc
attcctttgctgctgcagttgacaagccggctacagggagtccgcgcgctcggccaggca
gcctctgacaatagcggcccagaagatgcaaagagacaagccaagaaacagaagacaagg
cggacttga

DBGET integrated database retrieval system