KEGG   Homo sapiens (human): 23426Help
Entry
23426             CDS       T01001                                 

Gene name
GRIP1, FRASRS3, GRIP
Definition
(RefSeq) glutamate receptor interacting protein 1
  KO
K20251  glutamate receptor-interacting protein
Organism
hsa  Homo sapiens (human)
Disease
H00687  Fraser syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23426 (GRIP1)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Others
   Glutamate receptor-interacting proteins (GRIPs)
    23426 (GRIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 Tricorn_PDZ
Motif
Other DBs
NCBI-GeneID: 23426
NCBI-ProteinID: NP_066973
OMIM: 604597
HGNC: 18708
Ensembl: ENSG00000155974
Vega: OTTHUMG00000169019
Pharos: Q9Y3R0(Tbio)
UniProt: Q9Y3R0
Structure
PDB: 

Position
12q14.3
AA seq 1076 aa AA seqDB search
MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIPEEFKGSTVVELMKKE
GTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISL
LKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPV
VITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSV
MDSVATASGPLLVEVAKTPGASLGVALTTSMCCNKQVIVIDKIKSASIADRCGALHVGDH
ILSIDGTSMEYCTLAEATQFLANTTDQVKLEILPHHQTRLALKGPDHAALVSSSFSPTSM
SAYSLSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSLSLASSTVGLAGQVVHTETTE
VVLTADPVTGFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPT
EDSTFEEASQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHNVELGITISSPS
SRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKL
KIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTG
AIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPISSHL
SDLGDVEEDSSPAQKPGKLSDMYPSTVPSVDSAVDSWDGSAIDTSYGTQGTSFQASGYNF
NTYDWRSPKQRGSLSPVTKPRSQTYPDVGLSYEDWDRSTASGFAGAADSAETEQEENFWS
QALEDLETCGQSGILRELEEKADRRVSLRNMTLLATIMSGSTMSLNHEAPTPRSQLGRQA
SFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSD
MEDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIA
ESGNKLDLVISRNPLASQKSIDQQSLPGDWSEQNSAFFQQPSHGGNLETREPTNTL
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgtctcttttaaatgccgttgtcaaattctgaggcgacttactaaagatgag
agtccctacactaaatccgccagccagacaaagccgcctgatggagcgttggctgtgagg
agacagagcatcccagaggaattcaagggctccacagtcgtcgagctgatgaagaaggaa
ggcactaccctgggtctgacggtatcgggaggaattgataaggatggcaagccaagagta
tctaatctgcggcaaggaggaattgctgctagaagtgaccagctggatgtgggtgactac
atcaaagcagtgaatggaatcaacctggccaaattccgccatgacgagatcatcagcttg
ctgaagaatgtgggagaaagagtggttcttgaagtagagtacgagcttccaccggtctct
gtgcaaggatcaagtgttattttccgaacagtggaggtcacattacataaagaaggcaat
acctttggttttgtaattcgagggggagcacatgatgatagaaataaatctcgtccagtt
gtgataacatgtgttcgtcctggagggcctgctgacagagagggcacgatcaaacccggt
gacaggttgctcagtgtggatggaattcggcttcttggaactacgcatgctgaagccatg
agtattcttaaacaatgtggacaagaagcagcactgctgatagaatatgatgtctcagta
atggactctgtggcaacagcatccgggccactactagtcgaagttgccaaaactcctggt
gccagccttggggttgccctaactacctcgatgtgctgtaacaaacaagtcattgtcata
gacaaaatcaaatctgcaagtattgcagacagatgtggcgcattgcatgtgggagatcac
atcctctccatcgatggaaccagcatggagtactgtacacttgcagaagcaacccagttc
ctggccaacaccactgaccaggtcaagcttgagatccttccccatcatcagacccggctg
gccctaaaggggcccgaccatgcagctttggtgtcttcatccttctctcctacctccatg
agtgcatacagcctgagttccctgaacatggggactctacctcgaagcctctactccacc
agcccacgtggaaccatgatgaggaggagactgaaaaagaaagacttcaaaagctcattg
tccttagcctccagcacagtaggattggctgggcaggttgttcacacagaaaccacagag
gttgtgctgacggcagatcctgtcacaggatttgggatccaactgcagggcagtgtgttt
gccacagaaactctctcttctccacctctgatttcctatatcgaagctgacagcccagca
gagagatgtggggtgctacagattggagacagagtgatggccatcaatggaattccaaca
gaagacagcaccttcgaagaagccagtcagctcctccgagactcttcaatcacgagcaag
gtcacactggaaatcgagtttgatgttgcagagtctgtcatcccaagtagtggaacattt
catgtaaagctgcctaagaagcacaatgtggaacttggaataaccataagttcaccatcc
agtagaaaaccaggagaccccctcgtcatttcagatatcaagaaagggagtgtggcacac
agaactgggaccctggaacttggggataaattgctcgcaatagataatatccggctggac
aactgttccatggaagatgcagttcagatcctccagcaatgtgaagacctggtgaagctc
aaaatccgcaaagatgaagataattcagatgagcaagaaagttccggagcaattatttac
accgtggagcttaaacgctacggggggccccttggcatcacaatttcaggaactgaagag
ccgtttgatcctataatcatttcaagcctcactaaagggggattagctgaaagaactggc
gcaatccacataggagaccgaatcctagccatcaatagcagcagcttgaaagggaagcct
ctgagtgaagccatccatttgttacagatggcaggagagactgtcaccttgaaaattaag
aaacagacagatgcccagtcagcatcgagccccaagaagttccctatttctagccatttg
agtgacctgggggatgtggaggaggactcctcaccagcacagaagccaggcaagctctcc
gacatgtacccctccacggtgcccagtgtggacagtgctgtggattcatgggatgggtct
gcaatagacaccagctatggaactcaaggcactagttttcaggcctcaggatacaatttc
aacacctatgactggaggagtccaaaacagagaggcagcttgtccccagtcactaagcct
cgaagccagacttacccagatgtggggctgagttatgaagactgggaccggtccacagcc
agtggttttgcaggggctgccgatagtgcagagacagaacaagaggagaacttctggtct
caagcgctggaggatttggaaacctgcggacagtcaggaattctgagagaactggaggag
aaagctgacaggcgtgtgtctttgagaaacatgactctcttggcaacaatcatgtcgggg
agcacgatgagtttgaatcatgaggctccaacacctcgcagtcagctggggcgacaggcc
agcttccaggagcgcagcagctcgcggccgcactacagccaaacaactcggagcaacacc
ctgccttcagatgtgggtaggaagtcagtaaccctgagaaaaatgaaacaagaaataaag
gagatcatgtctccaactcctgtggagctgcacaaggtgaccttgtacaaggactctgac
atggaggactttgggttcagtgtagcagatggcttactggagaaaggagtgtatgtcaaa
aatattcgcccagctgggccaggagatcttggtggcttaaagccctatgacaggctctta
caggtgaatcatgtccgaaccagagactttgactgctgccttgttgtgcccctcatagca
gaatccgggaataagctggacctggttattagtagaaacccactggcttcacagaagtct
atagaccaacagagtctaccaggagattggagtgaacagaacagtgcttttttccagcag
cctagccacggtggtaatttggagacacgagaacccactaatacattatag

DBGET integrated database retrieval system