KEGG   Homo sapiens (human): 23428
Entry
23428             CDS       T01001                                 

Gene name
SLC7A8, LAT2, LPI-PC1
Definition
(RefSeq) solute carrier family 7 member 8
  KO
K13781  solute carrier family 7 (L-type amino acid transporter), member 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    23428 (SLC7A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    23428 (SLC7A8)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   23428 (SLC7A8)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 23428
NCBI-ProteinID: NP_036376
OMIM: 604235
HGNC: 11066
Ensembl: ENSG00000092068
Vega: OTTHUMG00000028720
Pharos: Q9UHI5(Tbio)
UniProt: Q9UHI5 Q53EM9
Position
14q11.2
AA seq 535 aa
MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGIFV
SPKGVLENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGF
LRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSV
RWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQ
GSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQELLASN
AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVK
RCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPI
KINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFI
ELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggaagaaggagccaggcaccgaaacaacaccgaaaagaaacacccaggtgggggcgag
tcggacgccagccccgaggctggttccggagggggcggagtagccctgaagaaagagatc
ggattggtcagtgcctgtggtatcatcgtagggaacatcatcggctctggaatctttgtc
tcgccaaagggagtgctggagaatgctggttctgtgggccttgctctcatcgtctggatt
gtgacgggcttcatcacagttgtgggagccctctgctatgctgaactcggggtcaccatc
cccaaatctggaggtgactactcctatgtcaaggacatcttcggaggactggctgggttc
ctgaggctgtggattgctgtgctggtgatctaccccaccaaccaggctgtcatcgccctc
accttctccaactacgtgctgcagccgctcttccccacctgcttccccccagagtctggc
cttcggctcctggctgccatctgcttattgctcctcacatgggtcaactgttccagtgtg
cggtgggccacccgggttcaagacatcttcacagctgggaagctcctggccttggccctg
attatcatcatggggattgtacagatatgcaaaggagagtacttctggctggagccaaag
aatgcatttgagaatttccaggaacctgacatcggcctcgtcgcactggctttccttcag
ggctcctttgcctatggaggctggaactttctgaattacgtgactgaggagcttgttgat
ccctacaagaaccttcccagagccatcttcatctccatcccactggtcacatttgtgtat
gtctttgccaatgtcgcttatgtcactgcaatgtccccccaggagctgctggcatccaac
gccgtcgctgtgacttttggagagaagctcctaggagtcatggcctggatcatgcccatt
tctgttgccctgtccacatttggaggagttaatgggtctctcttcacctcctctcggctg
ttcttcgctggagcccgagagggccaccttcccagtgtgttggccatgatccacgtgaag
cgctgcaccccaatcccagccctgctcttcacatgcatctccaccctgctgatgctggtc
accagcgacatgtacacactcatcaactatgtgggcttcatcaactacctcttctatggg
gtcacggttgctggacagatagtccttcgctggaagaagcctgatatcccccgccccatc
aagatcaacctgctgttccccatcatctacttgctgttctgggccttcctgctggtcttc
agcctgtggtcagagccggtggtgtgtggcattggcctggccatcatgctgacaggagtg
cctgtctatttcctgggtgtttactggcaacacaagcccaagtgtttcagtgacttcatt
gagctgctaaccctggtgagccagaagatgtgtgtggtcgtgtaccccgaggtggagcgg
ggctcagggacagaggaggctaatgaggacatggaggagcagcagcagcccatgtaccaa
cccactcccacgaaggacaaggacgtggcggggcagccccagccctga

DBGET integrated database retrieval system