KEGG   Homo sapiens (human): 23433Help
Entry
23433             CDS       T01001                                 

Gene name
RHOQ, ARHQ, HEL-S-42, RASL7A, TC10, TC10A
Definition
(RefSeq) ras homolog family member Q
  KO
K07194  Ras homolog gene family, member Q
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    23433 (RHOQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23433 (RHOQ)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    23433 (RHOQ)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    23433 (RHOQ)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    23433 (RHOQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 23433
NCBI-ProteinID: NP_036381
OMIM: 605857
HGNC: 17736
Ensembl: ENSG00000119729
Vega: OTTHUMG00000150653
Pharos: P17081(Tbio)
UniProt: P17081 V9HWD0
Structure
PDB: 

Position
2p21
AA seq 205 aa AA seqDB search
MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLG
LYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIG
TQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAII
AILTPKKHTVKKRIGSRCINCCLIT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgggcccggcgcgctgatgctcaagtgcgtggtggtcggcgacggggcggtg
ggcaagacgtgcctactcatgagctatgccaacgacgccttcccggaggagtacgtgccc
accgtcttcgaccactacgcagtcagcgtcaccgtggggggcaagcagtacctcctagga
ctctatgacacggccggacaggaagactatgaccgtctgaggcctttatcttacccaatg
accgatgtcttccttatatgcttctcggtggtaaatccagcctcatttcaaaatgtgaaa
gaggagtgggtaccggaacttaaggaatacgcaccaaatgtaccctttttattaatagga
actcagattgatctccgagatgaccccaaaactttagcaagactgaatgatatgaaagaa
aaacctatatgtgtggaacaaggacagaaactagcaaaagagataggagcatgctgctat
gtggaatgttcagctttaacccagaagggattgaagactgtttttgatgaggctatcata
gccattttaactccaaagaaacacactgtaaaaaaaagaataggatcaagatgtataaac
tgttgtttaattacgtga

DBGET integrated database retrieval system