KEGG   Homo sapiens (human): 23435
Entry
23435             CDS       T01001                                 
Symbol
TARDBP, ALS10, TDP-43
Name
(RefSeq) TAR DNA binding protein
  KO
K23600  TAR DNA-binding protein 43
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06418  Oxidative phosphorylation
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
N01154  TDP-43-regulated splicing
N01155  Mutation-caused aberrant TDP43 to TDP-43-regulated splicing
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    23435 (TARDBP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    23435 (TARDBP)
   05022 Pathways of neurodegeneration - multiple diseases
    23435 (TARDBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23435 (TARDBP)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     23435 (TARDBP)
SSDB
Motif
Pfam: TDP43_N RRM_1 RRM_7 RRM_3 RL
Other DBs
NCBI-GeneID: 23435
NCBI-ProteinID: NP_031401
OMIM: 605078
HGNC: 11571
Ensembl: ENSG00000120948
Pharos: Q13148(Tbio)
UniProt: Q13148 Q9H256 A0A024R4E2
Structure
Position
1:11012654..11030528
AA seq 414 aa
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA
QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG
NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgtctgaatatattcgggtaaccgaagatgagaacgatgagcccattgaaataccatcg
gaagacgatgggacggtgctgctctccacggttacagcccagtttccaggggcgtgtggg
cttcgctacaggaatccagtgtctcagtgtatgagaggtgtccggctggtagaaggaatt
ctgcatgccccagatgctggctggggaaatctggtgtatgttgtcaactatccaaaagat
aacaaaagaaaaatggatgagacagatgcttcatcagcagtgaaagtgaaaagagcagtc
cagaaaacatccgatttaatagtgttgggtctcccatggaaaacaaccgaacaggacctg
aaagagtattttagtacctttggagaagttcttatggtgcaggtcaagaaagatcttaag
actggtcattcaaaggggtttggctttgttcgttttacggaatatgaaacacaagtgaaa
gtaatgtcacagcgacatatgatagatggacgatggtgtgactgcaaacttcctaattct
aagcaaagccaagatgagcctttgagaagcagaaaagtgtttgtggggcgctgtacagag
gacatgactgaggatgagctgcgggagttcttctctcagtacggggatgtgatggatgtc
ttcatccccaagccattcagggcctttgcctttgttacatttgcagatgatcagattgcg
cagtctctttgtggagaggacttgatcattaaaggaatcagcgttcatatatccaatgcc
gaacctaagcacaatagcaatagacagttagaaagaagtggaagatttggtggtaatcca
ggtggctttgggaatcagggtggatttggtaatagcagagggggtggagctggtttggga
aacaatcaaggtagtaatatgggtggtgggatgaactttggtgcgttcagcattaatcca
gccatgatggctgccgcccaggcagcactacagagcagttggggtatgatgggcatgtta
gccagccagcagaaccagtcaggcccatcgggtaataaccaaaaccaaggcaacatgcag
agggagccaaaccaggccttcggttctggaaataactcttatagtggctctaattctggt
gcagcaattggttggggatcagcatccaatgcagggtcgggcagtggttttaatggaggc
tttggctcaagcatggattctaagtcttctggctggggaatgtag

DBGET integrated database retrieval system