KEGG   Homo sapiens (human): 23435Help
Entry
23435             CDS       T01001                                 

Gene name
TARDBP, ALS10, TDP-43
Definition
(RefSeq) TAR DNA binding protein
Organism
hsa  Homo sapiens (human)
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 RRM_3
Motif
Other DBs
NCBI-GeneID: 23435
NCBI-ProteinID: NP_031401
OMIM: 605078
HGNC: 11571
Ensembl: ENSG00000120948
Vega: OTTHUMG00000002120
Pharos: Q13148(Tbio)
UniProt: Q13148 Q9H256 A0A024R4E2
Structure
PDB: 

Position
1p36.22
AA seq 414 aa AA seqDB search
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA
QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG
NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatatattcgggtaaccgaagatgagaacgatgagcccattgaaataccatcg
gaagacgatgggacggtgctgctctccacggttacagcccagtttccaggggcgtgtggg
cttcgctacaggaatccagtgtctcagtgtatgagaggtgtccggctggtagaaggaatt
ctgcatgccccagatgctggctggggaaatctggtgtatgttgtcaactatccaaaagat
aacaaaagaaaaatggatgagacagatgcttcatcagcagtgaaagtgaaaagagcagtc
cagaaaacatccgatttaatagtgttgggtctcccatggaaaacaaccgaacaggacctg
aaagagtattttagtacctttggagaagttcttatggtgcaggtcaagaaagatcttaag
actggtcattcaaaggggtttggctttgttcgttttacggaatatgaaacacaagtgaaa
gtaatgtcacagcgacatatgatagatggacgatggtgtgactgcaaacttcctaattct
aagcaaagccaagatgagcctttgagaagcagaaaagtgtttgtggggcgctgtacagag
gacatgactgaggatgagctgcgggagttcttctctcagtacggggatgtgatggatgtc
ttcatccccaagccattcagggcctttgcctttgttacatttgcagatgatcagattgcg
cagtctctttgtggagaggacttgatcattaaaggaatcagcgttcatatatccaatgcc
gaacctaagcacaatagcaatagacagttagaaagaagtggaagatttggtggtaatcca
ggtggctttgggaatcagggtggatttggtaatagcagagggggtggagctggtttggga
aacaatcaaggtagtaatatgggtggtgggatgaactttggtgcgttcagcattaatcca
gccatgatggctgccgcccaggcagcactacagagcagttggggtatgatgggcatgtta
gccagccagcagaaccagtcaggcccatcgggtaataaccaaaaccaaggcaacatgcag
agggagccaaaccaggccttcggttctggaaataactcttatagtggctctaattctggt
gcagcaattggttggggatcagcatccaatgcagggtcgggcagtggttttaatggaggc
tttggctcaagcatggattctaagtcttctggctggggaatgtag

DBGET integrated database retrieval system