KEGG   Homo sapiens (human): 23436Help
Entry
23436             CDS       T01001                                 

Gene name
CELA3B, CBPP, ELA3B
Definition
(RefSeq) chymotrypsin like elastase family member 3B
  KO
K01345  pancreatic endopeptidase E [EC:3.4.21.70]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    23436 (CELA3B)
   04974 Protein digestion and absorption
    23436 (CELA3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.70  pancreatic endopeptidase E
     23436 (CELA3B)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   23436 (CELA3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 23436
NCBI-ProteinID: NP_031378
HGNC: 15945
Ensembl: ENSG00000219073
Vega: OTTHUMG00000002758
Pharos: P08861(Tbio)
UniProt: P08861
Position
1p36.12
AA seq 270 aa AA seqDB search
MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGG
SLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVAC
GNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALL
PVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVS
AFGCNTRRKPTVFTRVSAFIDWIEETIASH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatgctccggctgctcagttccctcctccttgtggccgttgcctcaggctatggccca
ccttcctctcgcccttccagccgcgttgtcaatggtgaggatgcggtcccctacagctgg
ccctggcaggtttccctgcagtatgagaaaagcggaagcttctaccacacctgtggcggt
agcctcatcgcccccgactgggttgtgactgccggccactgcatctcgagctcccggacc
taccaggtggtgttgggcgagtacgaccgtgctgtgaaggagggccccgagcaggtgatc
cccatcaactctggggacctctttgtgcatccactctggaaccgctcgtgtgtggcctgt
ggcaatgacatcgccctcatcaagctctcacgcagcgcccagctgggagacgccgtccag
ctcgcctcactccctccggctggtgacatccttcccaacgagacaccctgctacatcacc
ggctggggccgtctctataccaacgggccactcccagacaagctgcaggaggccctgctg
ccggtggtggactatgaacactgctccaggtggaactggtggggttcctccgtgaagaag
accatggtgtgtgctggaggggacatccgctccggctgcaatggtgactctggaggaccc
ctcaactgccccacagaggatggtggctggcaggtccatggcgtgaccagctttgtttct
gcctttggctgcaacacccgcaggaagcccacggtgttcactcgagtctccgccttcatt
gactggattgaggagaccatagcaagccactag

DBGET integrated database retrieval system