KEGG   Homo sapiens (human): 23443
Entry
23443             CDS       T01001                                 
Symbol
SLC35A3, AMRS
Name
(RefSeq) solute carrier family 35 member A3
  KO
K15272  solute carrier family 35 (UDP-sugar transporter), member A1/2/3
Organism
hsa  Homo sapiens (human)
Disease
H01392  Arthrogryposis, mental retardation, and seizures
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    23443 (SLC35A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   23443 (SLC35A3)
SSDB
Motif
Pfam: Nuc_sug_transp EamA UAA PUNUT CRT-like
Other DBs
NCBI-GeneID: 23443
NCBI-ProteinID: NP_036375
OMIM: 605632
HGNC: 11023
Ensembl: ENSG00000117620
Vega: OTTHUMG00000010805
Pharos: Q9Y2D2(Tbio)
UniProt: Q9Y2D2
Position
1:99969996..100035634
AA seq 325 aa
MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYK
DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLK
ILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVL
TACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGY
NRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFL
GAILVITATFLYGYDPKPAGNPTKA
NT seq 978 nt   +upstreamnt  +downstreamnt
atgttcgccaacctaaaatacgtttccctgggaattttggtctttcagactaccagtttg
gttctaacaatgcgttattccagaactttaaaagaagaaggacctcgttatctatcttct
acagcagtggttgttgctgaacttttgaagataatggcctgcattttattggtctacaaa
gacagcaaatgtagtctaagagcactgaatcgagtactacatgatgaaattcttaataaa
cctatggaaacacttaaacttgctattccatcagggatctatactcttcagaataattta
ctgtatgtggcactatcaaatctagatgcagctacttatcaggtcacgtatcagttaaaa
attcttacaacagcattattttctgtgtctatgcttagtaaaaaattgggtgtataccag
tggctgtccctagtaattttgatgacaggagttgcttttgtacagtggccctcagattct
cagcttgattctaaggaactttcagctggttctcaatttgtaggactcatggcagttctc
acagcatgtttttcaagtggctttgctggggtttactttgagaaaatcttaaaagaaaca
aaacaatcagtgtggataagaaatattcagcttggtttctttggaagtatatttggatta
atgggtgtatacatttatgatggagaactggtatcaaagaatggattttttcagggatat
aaccgactgacctggatagtagttgttcttcaggcacttggaggccttgtaatagctgct
gttattaagtatgcagataatattttaaaaggatttgcaacctctttatcgataatatta
tcaacattgatctcctatttttggcttcaagattttgtgccaaccagtgtctttttcctt
ggagccatccttgtaataacagctacttttttgtatggttatgatcccaaacctgcagga
aatcccactaaagcatag

DBGET integrated database retrieval system