KEGG   Homo sapiens (human): 23450
Entry
23450             CDS       T01001                                 

Gene name
SF3B3, RSE1, SAP130, SF3b130, STAF130
Definition
(RefSeq) splicing factor 3b subunit 3
  KO
K12830  splicing factor 3B subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    23450 (SF3B3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    23450 (SF3B3)
   03041 Spliceosome [BR:hsa03041]
    23450 (SF3B3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23450 (SF3B3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     23450 (SF3B3)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    23450 (SF3B3)
 Complex B
    23450 (SF3B3)
 Complex C
   U2 SnRNP specific factors
    23450 (SF3B3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    STAGA complex
     23450 (SF3B3)
    TFTC complex
     23450 (SF3B3)
SSDB
Motif
Pfam: MMS1_N CPSF_A
Other DBs
NCBI-GeneID: 23450
NCBI-ProteinID: NP_036558
OMIM: 605592
HGNC: 10770
Ensembl: ENSG00000189091
Vega: OTTHUMG00000137582
Pharos: Q15393(Tchem)
UniProt: Q15393 A8K6V3
Structure
PDB: 

Position
16q22.1
AA seq 1217 aa
MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFG
VIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQF
LAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENP
MFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFF
FLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQ
IAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDT
PQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPG
KKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQ
RSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSI
GFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFP
LQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAA
AFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTG
EDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQ
LIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRG
LLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDF
FQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgtttctgtacaacttaaccttgcagagagccactggcatcagctttgccattcatgga
aacttttctggaaccaaacaacaagaaattgttgtttcccgtgggaagatcttggagctg
cttcgcccagaccccaacactggcaaagtacataccctactcactgtggaagtattcggt
gttatccggtcactcatggcctttaggctgacaggtggcaccaaagactacattgtagtt
ggcagtgactctggtcgaattgttattttggaataccagccatctaagaatatgtttgag
aagattcaccaagaaacctttggcaagagtggatgccgtcgcatcgttcctggccagttc
ttagctgtggatcccaaagggcgagccgttatgattagtgccattgagaaacagaaattg
gtgtatattttgaacagagatgctgcagcccgacttaccatttcatctcccctggaagcc
cacaaagcaaacactttagtgtatcatgtagttggagtagatgtcggatttgaaaatcca
atgtttgcttgtctggaaatggattatgaggaagcagacaatgatccaacaggggaagca
gcagctaatacccagcagacacttactttctatgagctagaccttggtttaaatcatgtg
gtccgaaaatacagtgaacctttggaggaacacggcaacttccttattacagttccagga
gggtcagatggtccaagtggagtactgatctgctctgaaaactatattacttacaagaac
tttggtgaccagccagatatccgctgtccaattcccaggaggcggaatgacctggatgac
cctgaaagaggaatgatttttgtctgctctgcaacccataaaaccaaatcgatgttcttc
tttttggctcaaactgagcagggagatatctttaagatcactttggagacagatgaagat
atggttactgagatccggctcaaatattttgatactgtacccgttgctgctgccatgtgt
gtgcttaaaacagggttcctttttgtagcatcagaatttggaaaccattacttatatcaa
attgcacatcttggagatgatgatgaagaacctgagttttcatcagccatgcctctggaa
gaaggagacacattcttttttcagccaagaccacttaaaaaccttgtgctggttgatgag
ttggacagcctctctcccattctgttttgccagatagctgatctggccaatgaagatact
ccacagttgtatgtggcctgtggtaggggaccccgatcatctctgagagtcctaagacat
ggacttgaggtgtcagaaatggctgtttctgagctacctggtaaccccaacgctgtctgg
acagtgcgtcgacacattgaagatgagtttgatgcctacatcattgtgtctttcgtgaat
gccaccctagtgttgtccattggagaaactgtagaagaagtgactgactctgggttcctg
gggaccaccccgaccttgtcctgctccttattaggagatgatgccttggtgcaggtctat
ccagatggcattcggcacatacgagcagacaagagagtcaatgagtggaagacccctgga
aagaaaacaattgtgaagtgtgcagtgaaccagcgacaagtggtgattgccctgacagga
ggagagctggtctatttcgagatggatccttcaggacagctgaatgagtacacagaacgg
aaggagatgtcagcagatgtggtgtgcatgagtctggccaatgtaccccctggagagcag
cggtctcgcttcctggctgtggggcttgtggacaacactgtcagaatcatctccctggat
ccctcagactgtttgcaacctctaagcatgcaggctctcccagcccagcctgagtccttg
tgtatcgtggaaatgggtgggactgagaagcaggatgagctgggtgagaggggctcgatt
ggcttcctatacctgaatattgggctacagaacggtgtgctgctgaggactgtcttggac
cctgtcactggggatttgtctgatactcgcactcggtacctggggtcccgtcctgtgaag
ctcttccgagtccgaatgcaaggccaggaggcagtattggccatgtcaagccgctcatgg
ttgagctattcttaccaatctcgcttccatctcaccccactgtcttacgagacactggaa
tttgcatcgggttttgcctcggaacagtgtcccgagggcattgtggccatctccaccaac
accctacggattttggcattagagaagctcggtgctgtcttcaatcaagtagccttccca
ctgcagtacacacccaggaaatttgtcatccaccctgagagtaacaaccttattatcatt
gaaacggaccacaatgcctacactgaggccacgaaagctcagagaaagcagcagatggca
gaggaaatggtggaagcagcaggggaggatgagcgggagctggccgcagagatggcagca
gcattcctcaatgaaaacctccctgaatccatctttggagctcccaaggctggcaatggg
cagtgggcctctgtgatccgagtgatgaatcccattcaagggaacacactggaccttgtc
cagctggaacagaatgaggcagcttttagtgtggctgtgtgcaggttttccaacactggt
gaagactggtatgtgctggtgggtgtggccaaggacctgatactaaacccccgatctgtg
gcagggggcttcgtctatacttacaagcttgtgaacaatggggaaaaactggagtttttg
cacaagactcctgtggaagaggtccctgctgctattgccccattccaggggagggtgttg
attggtgtggggaagctgttgcgtgtctatgacctgggaaagaagaagttactccgaaaa
tgtgagaataagcatattgccaattatatctctgggatccagactatcggacatagggta
attgtatctgatgtccaagaaagtttcatctgggttcgctacaagcgtaatgaaaaccag
cttatcatctttgctgatgatacctacccccgatgggtcactacagccagcctcctggac
tatgacactgtggctggggcagacaagtttggcaacatatgtgtggtgaggctcccacct
aacaccaatgatgaagtagatgaggatcctacaggaaacaaagccctgtgggaccgtggc
ttgctcaatggggcctcccagaaggcagaggtgatcatgaactaccatgtcggggagacg
gtgctgtccttgcagaagaccacgctgatccctggaggctcagaatcacttgtctatacc
accttgtctggaggaattggcatccttgtgccattcacgtcccatgaggaccatgacttc
ttccagcatgtggaaatgcacctgcggtctgaacatccccctctctgtgggcgggaccac
ctcagctttcgctcctactacttccctgtgaagaatgtgattgatggagacctctgtgag
cagttcaattccatggaacccaacaaacaaaagaacgtctctgaagaactggaccgaacc
ccacccgaagtgtccaagaaactcgaggatatccggacccgctacgccttctga

DBGET integrated database retrieval system