KEGG   Homo sapiens (human): 23452
Entry
23452             CDS       T01001                                 
Symbol
ANGPTL2, ARP2, HARP
Name
(RefSeq) angiopoietin like 2
  KO
K25359  angiopoietin-related protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    23452 (ANGPTL2)
SSDB
Motif
Pfam: Fibrinogen_C Fer4_NifH zf-C4H2
Other DBs
NCBI-GeneID: 23452
NCBI-ProteinID: NP_036230
OMIM: 605001
HGNC: 490
Ensembl: ENSG00000136859
UniProt: Q9UKU9
Structure
Position
9:complement(127087348..127122635)
AA seq 493 aa
MRPLCVTCWWLGLLAAMGAVAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIV
PQQRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEV
KLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLE
HKYQHLATLAHNQSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVYQPPTYNRIINQISTN
EIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTN
RLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQ
GNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKK
VVMMIRPNPNTFH
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaggccactgtgcgtgacatgctggtggctcggactgctggctgccatgggagctgtt
gcaggccaggaggacggttttgagggcactgaggagggctcgccaagagagttcatttac
ctaaacaggtacaagcgggcgggcgagtcccaggacaagtgcacctacaccttcattgtg
ccccagcagcgggtcacgggtgccatctgcgtcaactccaaggagcctgaggtgcttctg
gagaaccgagtgcataagcaggagctagagctgctcaacaatgagctgctcaagcagaag
cggcagatcgagacgctgcagcagctggtggaggtggacggcggcattgtgagcgaggtg
aagctgctgcgcaaggagagccgcaacatgaactcgcgggtcacgcagctctacatgcag
ctcctgcacgagatcatccgcaagcgggacaacgcgttggagctctcccagctggagaac
aggatcctgaaccagacagccgacatgctgcagctggccagcaagtacaaggacctggag
cacaagtaccagcacctggccacactggcccacaaccaatcagagatcatcgcgcagctt
gaggagcactgccagagggtgccctcggccaggcccgtcccccagccaccccccgctgcc
ccgccccgggtctaccaaccacccacctacaaccgcatcatcaaccagatctctaccaac
gagatccagagtgaccagaacctgaaggtgctgccaccccctctgcccactatgcccact
ctcaccagcctcccatcttccaccgacaagccgtcgggcccatggagagactgcctgcag
gccctggaggatggccacgacaccagctccatctacctggtgaagccggagaacaccaac
cgcctcatgcaggtgtggtgcgaccagagacacgaccccgggggctggaccgtcatccag
agacgcctggatggctctgttaacttcttcaggaactgggagacgtacaagcaagggttt
gggaacattgacggcgaatactggctgggcctggagaacatttactggctgacgaaccaa
ggcaactacaaactcctggtgaccatggaggactggtccggccgcaaagtctttgcagaa
tacgccagtttccgcctggaacctgagagcgagtattataagctgcggctggggcgctac
catggcaatgcgggtgactcctttacatggcacaacggcaagcagttcaccaccctggac
agagatcatgatgtctacacaggaaactgtgcccactaccagaagggaggctggtggtat
aacgcctgtgcccactccaacctcaacggggtctggtaccgcgggggccattaccggagc
cgctaccaggacggagtctactgggctgagttccgaggaggctcttactcactcaagaaa
gtggtgatgatgatccgaccgaaccccaacaccttccactaa

DBGET integrated database retrieval system