KEGG   Homo sapiens (human): 23452Help
Entry
23452             CDS       T01001                                 

Gene name
ANGPTL2, ARP2, HARP
Definition
(RefSeq) angiopoietin like 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C zf-C4H2 Fer4_NifH Spc29
Motif
Other DBs
NCBI-GeneID: 23452
NCBI-ProteinID: NP_036230
OMIM: 605001
HGNC: 490
Ensembl: ENSG00000136859
Vega: OTTHUMG00000020695
Pharos: Q9UKU9(Tbio)
UniProt: Q9UKU9 A0A024R868
Position
9q33.3
AA seq 493 aa AA seqDB search
MRPLCVTCWWLGLLAAMGAVAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIV
PQQRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEV
KLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLE
HKYQHLATLAHNQSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVYQPPTYNRIINQISTN
EIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTN
RLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQ
GNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKK
VVMMIRPNPNTFH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaggccactgtgcgtgacatgctggtggctcggactgctggctgccatgggagctgtt
gcaggccaggaggacggttttgagggcactgaggagggctcgccaagagagttcatttac
ctaaacaggtacaagcgggcgggcgagtcccaggacaagtgcacctacaccttcattgtg
ccccagcagcgggtcacgggtgccatctgcgtcaactccaaggagcctgaggtgcttctg
gagaaccgagtgcataagcaggagctagagctgctcaacaatgagctgctcaagcagaag
cggcagatcgagacgctgcagcagctggtggaggtggacggcggcattgtgagcgaggtg
aagctgctgcgcaaggagagccgcaacatgaactcgcgggtcacgcagctctacatgcag
ctcctgcacgagatcatccgcaagcgggacaacgcgttggagctctcccagctggagaac
aggatcctgaaccagacagccgacatgctgcagctggccagcaagtacaaggacctggag
cacaagtaccagcacctggccacactggcccacaaccaatcagagatcatcgcgcagctt
gaggagcactgccagagggtgccctcggccaggcccgtcccccagccaccccccgctgcc
ccgccccgggtctaccaaccacccacctacaaccgcatcatcaaccagatctctaccaac
gagatccagagtgaccagaacctgaaggtgctgccaccccctctgcccactatgcccact
ctcaccagcctcccatcttccaccgacaagccgtcgggcccatggagagactgcctgcag
gccctggaggatggccacgacaccagctccatctacctggtgaagccggagaacaccaac
cgcctcatgcaggtgtggtgcgaccagagacacgaccccgggggctggaccgtcatccag
agacgcctggatggctctgttaacttcttcaggaactgggagacgtacaagcaagggttt
gggaacattgacggcgaatactggctgggcctggagaacatttactggctgacgaaccaa
ggcaactacaaactcctggtgaccatggaggactggtccggccgcaaagtctttgcagaa
tacgccagtttccgcctggaacctgagagcgagtattataagctgcggctggggcgctac
catggcaatgcgggtgactcctttacatggcacaacggcaagcagttcaccaccctggac
agagatcatgatgtctacacaggaaactgtgcccactaccagaagggaggctggtggtat
aacgcctgtgcccactccaacctcaacggggtctggtaccgcgggggccattaccggagc
cgctaccaggacggagtctactgggctgagttccgaggaggctcttactcactcaagaaa
gtggtgatgatgatccgaccgaaccccaacaccttccactaa

DBGET integrated database retrieval system