KEGG   Homo sapiens (human): 23457Help
Entry
23457             CDS       T01001                                 

Gene name
ABCB9, EST122234, TAPL
Definition
(RefSeq) ATP binding cassette subfamily B member 9
  KO
K05656  ATP-binding cassette, subfamily B (MDR/TAP), member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    23457 (ABCB9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    23457 (ABCB9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    23457 (ABCB9)
Transporters [BR:hsa02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    23457 (ABCB9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 RsgA_GTPase ABC_membrane_3 AAA_29 MCU DUF4191 AAA_30 AAA_23 AAA_15
Motif
Other DBs
NCBI-GeneID: 23457
NCBI-ProteinID: NP_062571
OMIM: 605453
HGNC: 50
Ensembl: ENSG00000150967
Vega: OTTHUMG00000168769
Pharos: Q9NP78(Tbio)
UniProt: Q9NP78 A0A024RBU1
Position
12q24.31
AA seq 766 aa AA seqDB search
MRLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCL
LLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMVKLLLFSEVRRPIRDPWFWALF
VWTYISLGASFLLWWLLSTVRPGTQALEPGAATEAEGFPGSGRPPPEQASGATLQKLLSY
TKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDGIVIQKSMDQFSTAVVIVCLLAIGSS
FAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLV
SQNINVFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNA
LARASNTAEETISAMKTVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTL
LVVQVSILYYGGHLVISGQMTSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVF
EFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGP
SGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVSQEPVLFARSITDNI
SYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRN
PPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQ
QGTHQQLLAQGGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgtggaaggcggtggtggtgactttggccttcatgagtgtggacatctgcgtg
accacggccatctatgtcttcagccacctggaccgcagcctcctggaggacatccgccac
ttcaacatctttgactcggtgctggatctctgggcagcctgcctgtaccgcagctgcctg
ctgctgggagccaccattggtgtggccaagaacagtgcgctggggccccggcggctgcgg
gcctcgtggctggtcatcaccctcgtgtgcctcttcgtgggcatctatgccatggtgaag
ctgctgctcttctcagaggtgcgcaggcccatccgggacccctggttttgggccctgttc
gtgtggacgtacatttcactcggcgcatccttcctgctctggtggctgctgtccaccgtg
cggccaggcacccaggccctggagccaggggcggccaccgaggctgagggcttccctggg
agcggccggccaccgcccgagcaggcgtctggggccacgctgcagaagctgctctcctac
accaagcccgacgtggccttcctcgtggccgcctccttcttcctcatcgtggcagctctg
ggagagaccttcctgccctactacacgggccgcgccattgatggcatcgtcatccagaaa
agcatggatcagttcagcacggctgtcgtcatcgtgtgcctgctggccattggcagctca
tttgccgcaggtattcggggcggcatttttaccctcatatttgccagactgaacattcgc
cttcgaaactgtctcttccgctcactggtgtcccaggagacaagcttctttgatgagaac
cgcacaggggacctcatctcccgcctgacctcggacaccaccatggtcagcgacctggtc
tcccagaacatcaatgtcttcctgcggaacacagtcaaggtcacgggcgtggtggtcttc
atgttcagcctctcatggcagctctccttggtcaccttcatgggcttccccatcatcatg
atggtgtccaacatctacggcaagtactacaagaggctctccaaagaggtccagaatgcc
ctggccagagcgagcaacacggcggaggagaccatcagtgccatgaagactgtccggagc
ttcgccaatgaggaggaggaggcagaggtgtacctgcggaagctgcagcaggtgtacaag
ctgaacaggaaggaggcagctgcctacatgtactacgtctggggcagcgggctcacactg
ctggtggtccaggtcagcatcctctactacgggggccaccttgtcatctcaggccagatg
accagcggcaacctcatcgccttcatcatctacgagtttgtcctgggagattgtatggag
tccgtgggctccgtctacagtggcctgatgcagggagtgggggctgctgagaaggtgttc
gagttcatcgaccggcagccgaccatggtgcacgatggcagcttggcccccgaccacctg
gagggccgggtggactttgagaatgtgaccttcacctaccgcactcggccccacacccag
gtcctgcagaatgtctccttcagcctgtcccccggcaaggtgacggccctggtggggccc
tcgggcagtgggaagagctcctgtgtcaacatcctggagaacttctaccccctggagggg
ggccgggtgctgctggacggcaagcccatcagcgcctacgaccacaagtacttgcaccgt
gtgatctccctggtgagccaggagcccgtgctgttcgcccgctccatcacggataacatc
tcctacggcctgcccactgtgcctttcgagatggtggtggaggccgcacagaaggccaat
gcccacggcttcatcatggaactccaggacggctacagcacagagacaggggagaagggc
gcccagctgtcaggtggccagaagcagcgggtggccatggcccgggctctggtgcggaac
cccccagtcctcatcctggatgaagccaccagcgctttggatgccgagagcgagtatctg
atccagcaggccatccatggcaacctgcagaagcacacggtactcatcatcgcgcaccgg
ctgagcaccgtggagcacgcgcacctcattgtggtgctggacaagggccgcgtagtgcag
cagggcacccaccagcagctgctggcccagggcggcctctacgccaagctggtgcagcgg
cagatgctggggcttcagcccgccgcagacttcacagctggccacaacgagcctgtagcc
aacggcagtcacaaggcctga

DBGET integrated database retrieval system