KEGG   Homo sapiens (human): 2346Help
Entry
2346              CDS       T01001                                 

Gene name
FOLH1, FGCP, FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA, mGCP
Definition
(RefSeq) folate hydrolase 1
  KO
K14592  glutamate carboxypeptidase II (folate hydrolase 1) [EC:3.4.17.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa04977  Vitamin digestion and absorption
Drug target
Capromab pendetide: D03372
Indium (111In) capromab pendetide: D04525
Iofolastat I 123: D10070
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2346 (FOLH1)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    2346 (FOLH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    2346 (FOLH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     2346 (FOLH1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   2346 (FOLH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFR_dimer Peptidase_M28 PA
Motif
Other DBs
NCBI-GeneID: 2346
NCBI-ProteinID: NP_004467
OMIM: 600934
HGNC: 3788
Ensembl: ENSG00000086205
Vega: OTTHUMG00000166625
Pharos: Q04609(Tchem)
UniProt: Q04609
Structure
PDB: 

Position
11p11.12
AA seq 750 aa AA seqDB search
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP
NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA
RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK
SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY
DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG
TLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKE
LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN
WETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY
AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIV
LRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVD
PSKAWGEVKRQIYVAAFTVQAAAETLSEVA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatctccttcacgaaaccgactcggctgtggccaccgcgcgccgcccgcgctgg
ctgtgcgctggggcgctggtgctggcgggtggcttctttctcctcggcttcctcttcggg
tggtttataaaatcctccaatgaagctactaacattactccaaagcataatatgaaagca
tttttggatgaattgaaagctgagaacatcaagaagttcttatataattttacacagata
ccacatttagcaggaacagaacaaaactttcagcttgcaaagcaaattcaatcccagtgg
aaagaatttggcctggattctgttgagctagcacattatgatgtcctgttgtcctaccca
aataagactcatcccaactacatctcaataattaatgaagatggaaatgagattttcaac
acatcattatttgaaccacctcctccaggatatgaaaatgtttcggatattgtaccacct
ttcagtgctttctctcctcaaggaatgccagagggcgatctagtgtatgttaactatgca
cgaactgaagacttctttaaattggaacgggacatgaaaatcaattgctctgggaaaatt
gtaattgccagatatgggaaagttttcagaggaaataaggttaaaaatgcccagctggca
ggggccaaaggagtcattctctactccgaccctgctgactactttgctcctggggtgaag
tcctatccagatggttggaatcttcctggaggtggtgtccagcgtggaaatatcctaaat
ctgaatggtgcaggagaccctctcacaccaggttacccagcaaatgaatatgcttatagg
cgtggaattgcagaggctgttggtcttccaagtattcctgttcatccaattggatactat
gatgcacagaagctcctagaaaaaatgggtggctcagcaccaccagatagcagctggaga
ggaagtctcaaagtgccctacaatgttggacctggctttactggaaacttttctacacaa
aaagtcaagatgcacatccactctaccaatgaagtgacaagaatttacaatgtgataggt
actctcagaggagcagtggaaccagacagatatgtcattctgggaggtcaccgggactca
tgggtgtttggtggtattgaccctcagagtggagcagctgttgttcatgaaattgtgagg
agctttggaacactgaaaaaggaagggtggagacctagaagaacaattttgtttgcaagc
tgggatgcagaagaatttggtcttcttggttctactgagtgggcagaggagaattcaaga
ctccttcaagagcgtggcgtggcttatattaatgctgactcatctatagaaggaaactac
actctgagagttgattgtacaccgctgatgtacagcttggtacacaacctaacaaaagag
ctgaaaagccctgatgaaggctttgaaggcaaatctctttatgaaagttggactaaaaaa
agtccttccccagagttcagtggcatgcccaggataagcaaattgggatctggaaatgat
tttgaggtgttcttccaacgacttggaattgcttcaggcagagcacggtatactaaaaat
tgggaaacaaacaaattcagcggctatccactgtatcacagtgtctatgaaacatatgag
ttggtggaaaagttttatgatccaatgtttaaatatcacctcactgtggcccaggttcga
ggagggatggtgtttgagctagccaattccatagtgctcccttttgattgtcgagattat
gctgtagttttaagaaagtatgctgacaaaatctacagtatttctatgaaacatccacag
gaaatgaagacatacagtgtatcatttgattcacttttttctgcagtaaagaattttaca
gaaattgcttccaagttcagtgagagactccaggactttgacaaaagcaacccaatagta
ttaagaatgatgaatgatcaactcatgtttctggaaagagcatttattgatccattaggg
ttaccagacaggcctttttataggcatgtcatctatgctccaagcagccacaacaagtat
gcaggggagtcattcccaggaatttatgatgctctgtttgatattgaaagcaaagtggac
ccttccaaggcctggggagaagtgaagagacagatttatgttgcagccttcacagtgcag
gcagctgcagagactttgagtgaagtagcctaa

DBGET integrated database retrieval system