KEGG   Homo sapiens (human): 23463Help
Entry
23463             CDS       T01001                                 

Gene name
ICMT, HSTE14, MST098, MSTP098, PCCMT, PCMT, PPMT
Definition
(RefSeq) isoprenylcysteine carboxyl methyltransferase
  KO
K00587  protein-S-isoprenylcysteine O-methyltransferase [EC:2.1.1.100]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    23463 (ICMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.100  protein-S-isoprenylcysteine O-methyltransferase
     23463 (ICMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICMT PEMT DUF1295
Motif
Other DBs
NCBI-GeneID: 23463
NCBI-ProteinID: NP_036537
OMIM: 605851
HGNC: 5350
Ensembl: ENSG00000116237
Vega: OTTHUMG00000001254
Pharos: O60725(Tchem)
UniProt: O60725 A0A024R4F6
Position
1p36.31
AA seq 284 aa AA seqDB search
MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFT
AGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTV
WRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctgcgcggcgcgggctccgccgggctctgaggcgcgtctcagcctcgccacc
ttcctgctgggcgcctcggtgctcgcgctgccgctgctcacgcgcgccggcctgcagggc
cgcaccgggctggcgctctacgtggccgggctcaacgcgctgctgctgctgctctatcgg
ccgcctcgctaccagatagccatccgagcttgtttcctggggtttgtgttcggctgcggc
acgctgctaagttttagccagtcttcttggagtcactttggctggtacatgtgctccctg
tcattgttccactattctgaatacttggtgacagcagtcaataatcccaaaagtctgtcc
ttggattcctttctcctgaatcacagcctggagtatacagtagctgctctttcttcttgg
ttagagttcacacttgaaaatatcttttggccagaactgaagcagattacctggctcagt
gtcacagggctgctgatggtggtcttcggagaatgtctgaggaaggcggccatgtttaca
gctggctccaatttcaaccacgtggtacagaatgaaaaatcagatacacatactctggtg
accagtggagtgtacgcttggtttcggcatccttcttacgtcgggtggttttactggagt
attggaactcaggtgatgctgtgtaaccccatctgcggcgtcagctatgccctgacagtg
tggcgattcttccgcgatcgaacagaagaagaagaaatctcactaattcacttttttgga
gaggagtacctggagtataagaagagggtgcccacgggcctgcctttcataaagggggtc
aaggtggacctgtga

DBGET integrated database retrieval system