KEGG   Homo sapiens (human): 23464
Entry
23464             CDS       T01001                                 

Gene name
GCAT, KBL
Definition
(RefSeq) glycine C-acetyltransferase
  KO
K00639  glycine C-acetyltransferase [EC:2.3.1.29]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    23464 (GCAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    23464 (GCAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     23464 (GCAT)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class II
   23464 (GCAT)
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1
Other DBs
NCBI-GeneID: 23464
NCBI-ProteinID: NP_055106
OMIM: 607422
HGNC: 4188
Ensembl: ENSG00000100116
Vega: OTTHUMG00000150664
Pharos: O75600(Tbio)
UniProt: O75600 A8K228
Position
22q13.1
AA seq 419 aa
MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRV
DGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQSIHKNLEAKIA
RFHQREDAILYPSCYDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLD
MADLEAKLQEAQKHRLRLVATDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLG
PTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPP
AVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGASHPICPVMLGDARLAS
RMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGALP
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgtggcctgggaacgcctggcgcgccgcactcttctgggtgccccgcggccgccgcgca
cagtcagcgctggcccagctgcgtggcattctggagggggagctggaaggcatccgcgga
gctggcacttggaagagtgagcgggtcatcacgtcccgtcaggggccgcacatccgcgtg
gacggcgtctccggaggaatccttaacttctgtgccaacaactacctgggcctgagcagc
caccctgaggtgatccaggcaggtctgcaggctctggaggagtttggagctggcctcagc
tctgtccgctttatctgtggaacccagagcatccacaagaatctagaagcaaaaatagcc
cgcttccaccagcgggaggatgccatcctctatcccagctgttatgacgccaacgccggc
ctctttgaggccctgctgaccccagaggacgcagtcctgtcggacgagctgaaccatgcc
tccatcatcgacggcatccggctgtgcaaggcccacaagtaccgctatcgccacctggac
atggccgacctagaagccaagctgcaggaggcccagaagcatcggctgcgcctggtggcc
actgatggggccttttccatggatggcgacatcgcacccctgcaggagatctgctgcctc
gcctctagatatggtgccctggtcttcatggatgaatgccatgccactggcttcctgggg
cccacaggacggggcacagatgagctgctgggtgtgatggaccaggtcaccatcatcaac
tccaccctggggaaggccctgggtggagcatcagggggctacacgacagggcctgggccc
ctggtgtccctgctgcggcagcgcgcccggccatacctcttctccaacagtctgccacct
gctgtcgttggctgcgcctccaaggccctagatctgctgatggggagtaacaccattgtc
cagtctatggctgccaagacccagaggttccgtagtaagatggaagctgctggcttcact
atctcgggagccagtcaccccatctgccctgtgatgctgggtgatgcccggctggcctct
cgcatggcggatgacatgctgaagagaggcatctttgtcatcgggttcagctaccccgtg
gtccccaagggcaaggcccggatccgggtacagatctcagcagtgcatagcgaggaagac
attgaccgctgcgtggaggccttcgtggaagtggggcgactgcacggggcactgccctga

DBGET integrated database retrieval system