KEGG   Homo sapiens (human): 23466
Entry
23466             CDS       T01001                                 
Symbol
CBX6
Name
(RefSeq) chromobox 6
  KO
K11453  chromobox protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23466 (CBX6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     23466 (CBX6)
SSDB
Motif
Pfam: Chromo CBX7_C Mtf2_C
Other DBs
NCBI-GeneID: 23466
NCBI-ProteinID: NP_055107
OMIM: 617438
HGNC: 1556
Ensembl: ENSG00000183741
Pharos: O95503(Tdark)
UniProt: O95503
Structure
Position
22:complement(38861422..38872216)
AA seq 412 aa
MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQK
ERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLK
KDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKV
IDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPA
PLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETV
SPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRP
EMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggagctgtctgcagtgggcgagcgggtcttcgcggccgaatccatcatcaaacggcgg
atccgaaagggacgcatcgagtacctggtgaaatggaaggggtgggcgatcaagtacagc
acttgggagcccgaggagaacatcctggactcgcggctcattgcagccttcgaacaaaag
gagagggagcgtgagctgtatgggcccaagaagaggggacccaaacccaaaactttcctc
ctgaaggcgcgggcccaggccgaggccctccgcatcagtgatgtgcatttctctgtcaag
ccgagcgccagtgcctcctcgcccaagctgcactccagcgcagccgtgcaccggctcaag
aaggacatccgccgctgccaccgtatgtcccgccgtcccctgccccgcccggacccgcag
gggggcagccccggactgcgcccgcccatttcgcccttctcggagacggtgcgcatcatc
aaccgcaaggtgaagccgcgggagcccaagcggaaccgcatcatcctgaacctgaaggtg
atcgacaagggcgctggcggcgggggcgccgggcagggggccggggcgctggcccgcccc
aaagtcccctcgcggaaccgcgttataggcaagagcaagaagttcagcgagagcgtcctg
cgtacacagatccgccacatgaagttcggcgcctttgcgctgtacaagcctccgcccgcc
cccctggtagccccgtcccccggcaaggctgaggcctcagccccgggccctgggctactt
ctggccgcccccgccgccccctacgacgcccgcagctctggctcctccggctgcccctcg
cctacaccacagtcctctgaccccgacgacacgccccccaagctcctccccgagaccgtg
agcccatccgcccccagctggcgcgagccggaggtgctcgacctgtccctccctcccgag
tcggcagccaccagcaagcgggcaccgcctgaggtcacagctgctgccggcccggcacct
cccacggcccctgagcccgccggtgcctcctccgagcccgaggctggggactggcgcccc
gagatgtcaccctgctccaatgtggtcgtcaccgatgtcaccagcaacctcctgacggtc
acaatcaaggaattctgcaaccctgaggatttcgagaaggtggctgctggggtagcaggc
gccgctgggggcggtggcagcattggggcgagcaagtga

DBGET integrated database retrieval system