KEGG   Homo sapiens (human): 23467
Entry
23467             CDS       T01001                                 
Symbol
NPTXR, NPR
Name
(RefSeq) neuronal pentraxin receptor
  KO
K25710  neuronal pentraxin receptor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    23467 (NPTXR)
SSDB
Motif
Pfam: Pentaxin Laminin_G_3 SlyX
Other DBs
NCBI-GeneID: 23467
NCBI-ProteinID: NP_055108
OMIM: 609474
HGNC: 7954
Ensembl: ENSG00000221890
UniProt: O95502
Position
22:complement(38818452..38844028)
AA seq 500 aa
MKFLAVLLAAGMLAFLGAVICIIASVPLAASPARALPGGADNASVASGAAASPGPQRSLS
ALHGAGGSAGPPALPGAPAASAHPLPPGPLFSRFLCTPLAAACPSGAQQGDAAGAAPGER
EELLLLQSTAEQLRQTALQQEARIRADQDTIRELTGKLGRCESGLPRGLQGAGPRRDTMA
DGPWDSPALILELEDAVRALRDRIDRLEQELPARVNLSAAPAPVSAVPTGLHSKMDQLEG
QLLAQVLALEKERVALSHSSRRQRQEVEKELDVLQGRVAELEHGSSAYSPPDAFKISIPI
RNNYMYARVRKALPELYAFTACMWLRSRSSGTGQGTPFSYSVPGQANEIVLLEAGHEPME
LLINDKVAQLPLSLKDNGWHHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGIL
ILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLV
EAFGGATKAAFDVCKGRAKA
NT seq 1503 nt   +upstreamnt  +downstreamnt
ctgaagttcctggccgtgctgctggccgcgggcatgctggcgttcctcggtgccgtcatc
tgcatcatcgccagcgtgcccctggcggccagcccggcgcgggcgctgcccggcggcgcc
gacaatgcttcggtcgcctcgggcgccgccgcgtccccgggcccgcagcggagcctgagc
gcgctgcacggcgcgggcggttcagccgggccccccgcgctgcccggggcacccgcggcc
agcgcgcacccgctgccgcccgggcccctgttcagccgcttcctgtgcacgccgctggct
gctgcctgcccgtcgggggcccagcagggggacgcggcgggcgctgcgccgggcgagcgc
gaagagctgctgctgctgcagagcacggccgagcagctgcgccagacggcgctgcagcag
gaggcgcgcatccgcgccgaccaggacaccatccgtgagctcaccggcaagctgggccgc
tgcgagagcggcctgccgcgcggcctccagggcgccgggccccgccgcgacaccatggcc
gacgggccctgggactcgcctgcgctcattctggagctggaggacgccgtgcgcgccctg
cgggaccgcatcgaccgcctggagcaggagcttccagcccgtgtgaacctctcagctgcc
ccagccccagtctctgctgtgcccaccggcctacactccaagatggaccagctggagggg
cagctgctggcccaggtgctggcactggagaaggagcgtgtggccctcagccacagcagc
cgccggcagaggcaggaagtggaaaaggagttggacgtcctgcagggtcgtgtggctgag
ctggagcacgggtcctcagcctacagtcctccagatgccttcaagatcagcatccccatc
cgtaacaactacatgtacgcccgcgtgcggaaggctctgcccgagctctacgcattcacc
gcctgcatgtggctgcggtccaggtccagcggcaccggccagggcacccccttctcctac
tcagtgcccgggcaggccaacgagattgtactgctagaggcgggccatgagcccatggag
ctgctgatcaacgacaaggtggcccagctgcccctgagcctgaaggacaatggctggcac
cacatctgcatcgcctggaccacaagggatggcctatggtctgcctaccaggacggggag
ctgcagggctccggtgagaacctggctgcctggcaccccatcaagcctcatgggatcctt
atcttgggccaggagcaggataccctgggtggccggtttgatgccacccaggcctttgtc
ggtgacattgcccagtttaacctgtgggaccacgccctgacaccagcccaggtcctgggc
attgccaactgcactgcgccactgctgggcaacgtccttccctgggaagacaagttggtg
gaggcctttgggggtgcaacaaaggctgccttcgatgtctgcaaggggagggccaaggca
tga

DBGET integrated database retrieval system