KEGG   Homo sapiens (human): 23471Help
Entry
23471             CDS       T01001                                 

Gene name
TRAM1, PNAS8, TRAM, TRAMP
Definition
(RefSeq) translocation associated membrane protein 1
  KO
K14010  translocating chain-associated membrane protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23471 (TRAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1 DUF3382 DUF3671
Motif
Other DBs
NCBI-GeneID: 23471
NCBI-ProteinID: NP_055109
OMIM: 605190
HGNC: 20568
Ensembl: ENSG00000067167
Vega: OTTHUMG00000164428
Pharos: Q15629(Tbio)
UniProt: Q15629 Q6FHL3
Position
8q13.3
AA seq 374 aa AA seqDB search
MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLP
ATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFN
ESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAF
PELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFY
FSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAV
LASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTS
NVADSPRNKKEKSS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgattcgcaagaaaagcaccaagagccccccagtgctgagccacgaattcgtcctg
cagaatcacgcggacatcgtctcctgtgtggcgatggtcttcctgctggggctcatgttt
gagataacggcaaaagcttctatcatttttgttactcttcagtacaatgtcaccctccca
gcaacagaagaacaagctactgaatcagtgtccctttattactatggcatcaaagatttg
gctactgttttcttctacatgctagtggcgataattattcatgccgtaattcaagagtat
atgttggataaaattaacaggcgaatgcacttctccaaaacaaaacacagcaagtttaat
gaatctggtcagcttagtgcgttctacctttttgcctgtgtttggggcacattcattctc
atctctgaaaactacatctcagacccaactatcttatggagggcttatccccataacctg
atgacatttcaaatgaagtttttctacatatcacagctggcttactggcttcatgctttt
cctgaactctacttccagaaaaccaaaaaagaagatattcctcgtcagcttgtctacatt
ggtctttacctcttccacattgctggagcttaccttttgaacttgaatcatctaggactt
gttcttctggtgctacattattttgttgaatttcttttccacatttcccgcctgttttat
tttagcaatgaaaagtatcagaaaggattttctctgtgggcagttctttttgttttggga
agacttctgactttaattctttcagtactgactgttggttttggccttgcaagagcagaa
aatcagaagctggatttcagtactggaaacttcaatgtgttagctgttagaatcgctgtt
ctggcatccatttgcgttactcaggcatttatgatgtggaagttcattaattttcagctt
cgaaggtggagggaacattctgcttttcaggcaccagctgtgaagaagaaaccaacagta
actaaaggcagatcttctaaaaaaggaacagaaaatggtgtgaatggaacattaacttca
aatgtagcagactctccccggaataaaaaagagaaatcttcataa

DBGET integrated database retrieval system