KEGG   Homo sapiens (human): 23473Help
Entry
23473             CDS       T01001                                 

Gene name
CAPN7, CALPAIN7, PALBH
Definition
(RefSeq) calpain 7
  KO
K08576  calpain-7 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    23473 (CAPN7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     23473 (CAPN7)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C2: calpain family
   23473 (CAPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 MIT Calpain_III T2SSF
Motif
Other DBs
NCBI-GeneID: 23473
NCBI-ProteinID: NP_055111
OMIM: 606400
HGNC: 1484
Ensembl: ENSG00000131375
Vega: OTTHUMG00000129863
Pharos: Q9Y6W3(Tbio)
UniProt: Q9Y6W3 Q7Z479
Structure
PDB: 

Position
3p25.1
AA seq 813 aa AA seqDB search
MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEY
LERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLC
LKTSYETADKVLQNKLKQLARQALDRAEALSEPLTKPVGKISSTSVKPKPPPVRAHFPLG
ANPFLERPQSFISPQSCDAQGQRYTAEEIEVLRTTSKINGIEYVPFMNVDLRERFAYPMP
FCDRWGKLPLSPKQKTTFSKWVRPEDLTNNPTMIYTVSSFSIKQTIVSDCSFVASLAISA
AYERRFNKKLITGIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELL
CSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNSNIDLHALTGWIPERIAMHSDSQTFSKD
NSFRMLYQRFHKGDVLITASTGMMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPW
SHLRWKGRYSENDVKNWTPELQKYLNFDPRTAQKIDNGIFWISWDDLCQYYDVIYLSWNP
GLFKESTCIHSTWDAKQGPVKDAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDKDDFA
NNREFITMVVYKTDGKKVYYPADPPPYIDGIRINSPHYLTKIKLTTPGTHTFTLVVSQYE
KQNTIHYTVRVYSACSFTFSKIPSPYTLSKRINGKWSGQSAGGCGNFQETHKNNPIYQFH
IEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFCYLELENIPSG
IFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggacgccacagcactggagcgggacgctgtgcagttcgcccgtctggcggttcagcgc
gaccacgaaggccgctactccgaggcggtgttttattacaaggaagctgcacaagcctta
atttatgctgagatggcaggatcaagcctagaaaatattcaagaaaaaataactgagtat
ctggaaagagttcaagctctacattcagcagttcagtcaaagagtgctgatcctttgaag
tcaaaacatcagttggacttagagcgtgctcatttccttgttacacaagcttttgatgaa
gatgaaaaagagaatgttgaagatgctatagaattgtacacagaagctgtggatctctgt
ctgaaaacatcttatgaaactgctgataaagtcctgcaaaataaactgaaacagttggct
cgacaggcactagacagagcagaagcgctgagtgagcctttgaccaagccagttggcaaa
atcagttcaacaagtgttaagccaaagccacctccagtgagagcacattttccactgggc
gctaatcccttccttgaaagacctcagtcatttataagtcctcagtcatgtgatgcacaa
ggacagagatacacagcagaagaaatagaagtactcaggacaacatcaaaaataaatggt
atagaatatgttcctttcatgaatgttgacctgagagaacgttttgcctatccaatgcct
ttctgtgatagatggggcaagctaccattatcacctaaacaaaaaactacattttccaag
tgggtacgaccagaagacctcaccaacaatcctacaatgatatatactgtgtccagtttt
agcataaagcagacaatagtatcggattgctcctttgtggcatcactggccatcagtgca
gcttatgaaagacgttttaataagaagttaattaccggcataatttaccctcaaaacaag
gatggtgaaccagaatacaatccatgtgggaagtatatggtaaaacttcacctcaatggt
gtcccaagaaaggtgataattgatgaccagttacctgttgatcacaagggagaattgctc
tgttcttattccaacaacaaaagtgaattatgggtttctctcatagaaaaagcatacatg
aaagtcatgggaggatatgattttccaggatccaactccaatattgatcttcatgcactg
actggctggataccagaaagaattgctatgcattcagatagccaaactttcagtaaggat
aattctttcagaatgctttatcaaagatttcacaaaggagatgtcctcatcactgcgtca
actggaatgatgacagaagctgaaggagagaagtggggtctggttcccacacacgcatat
gctgttttggatattagagagttcaaggggctgcgatttatccagttgaaaaatccttgg
agtcatttacgttggaaaggaagatacagtgaaaatgatgtaaaaaactggactccagag
ttgcaaaagtatttaaactttgatccccgaacagctcagaaaatagacaacggaatattt
tggatttcctgggatgatctctgccagtattatgatgtgatttatttgagttggaatcca
ggtctttttaaagaatcaacatgtattcacagtacttgggatgctaagcaaggacctgtg
aaagatgcctatagcctggccaacaacccccagtacaaactggaggtgcagtgtccacag
gggggtgctgcagtttgggttttgcttagtagacacataacagacaaggatgattttgcg
aataatcgagaatttatcacaatggttgtatacaagactgatgggaaaaaagtttattac
ccagctgacccacctccatacattgatggaattcgaattaacagccctcattatttgact
aagataaagctgaccacacctggcacccatacctttacattagtggtttctcaatatgaa
aaacagaacacaatccattacacggttcgggtatattcagcatgcagctttactttttca
aagattccttcaccatacaccttatcaaaacggattaatggaaagtggagtggtcagagt
gctggaggatgtggaaatttccaagagactcacaaaaataaccccatctaccaattccat
atagaaaagactgggccgttactgattgagctacgaggaccaaggcaatatagcgttgga
tttgaggttgtaacagtttctactctaggagatcctggtccccatggctttctgaggaaa
tctagtggtgactataggtgtgggttttgctacctggaattagaaaatataccttctggg
atcttcaatatcattcctagtacctttttgcctaaacaagaaggaccttttttcttggac
tttaatagtattatccccatcaagatcacacaacttcagtga

DBGET integrated database retrieval system