KEGG   Homo sapiens (human): 23475Help
Entry
23475             CDS       T01001                                 

Gene name
QPRT, HEL-S-90n, QPRTase
Definition
(RefSeq) quinolinate phosphoribosyltransferase
  KO
K00767  nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    23475 (QPRT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     23475 (QPRT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: QRPTase_C QRPTase_N TMP-TENI
Motif
Other DBs
NCBI-GeneID: 23475
NCBI-ProteinID: NP_055113
OMIM: 606248
HGNC: 9755
Ensembl: ENSG00000103485
Vega: OTTHUMG00000097770
Pharos: Q15274(Tbio)
UniProt: Q15274 V9HWJ5 B4DDH4
Structure
PDB: 

Position
16p11.2
AA seq 297 aa AA seqDB search
MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFF
DAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAA
AVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG
VEKAVRAARQAADFALKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQF
PSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgaaggcctggcgctgctgctgccgcccgtcaccctggcagccctggtggac
agctggctccgagaggactgcccagggctcaactacgcagccttggtcagcggggcaggc
ccctcgcaggcggcgctgtgggccaaatcccctggggtactggcagggcagcctttcttc
gatgccatatttacccaactcaactgccaagtctcctggttcctccccgagggatcgaag
ctggtgccggtggccagagtggccgaggtccggggccctgcccactgcctgctgctgggg
gaacgggtggccctcaacacgctggcccgctgcagtggcattgccagtgctgccgccgct
gcagtggaggccgccaggggggccggctggactgggcacgtggcaggcacgaggaagacc
acgccaggcttccggctggtggagaagtatgggctcctggtgggcggggccgcctcgcac
cgctacgacctgggagggctggtgatggtgaaggataaccatgtggtggccgccggtggc
gtggagaaggcggtgcgggcggccagacaggcggctgacttcgctctgaaggtggaagtg
gaatgcagcagcctgcaggaggccgtgcaggcagctgaggctggtgccgaccttgtcctg
ctggacaacttcaagccagaggagctgcaccccacggccaccgtgctgaaggcccagttc
ccgagtgtggctgtggaagccagtgggggcatcaccctggacaacctcccccagttctgc
gggccgcacatagacgtcatctccatggggatgctgacccaggcggccccagcccttgat
ttctccctcaagctgtttgccaaagaggtggctccagtgcccaaaatccactag

DBGET integrated database retrieval system