KEGG   Homo sapiens (human): 23476
Entry
23476             CDS       T01001                                 
Symbol
BRD4, CAP, HUNK1, HUNKI, MCAP
Name
(RefSeq) bromodomain containing 4
  KO
K11722  bromodomain-containing protein 4
Organism
hsa  Homo sapiens (human)
Drug target
Apabetalone: D11131
Birabresib: D10911
Mivebresib: D11479
Molibresib (DG02993): D11326 D11347
Pelabresib: D12266
Trotabresib: D12006
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23476 (BRD4)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    23476 (BRD4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23476 (BRD4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   23476 (BRD4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Brd4/P-TEFb complex
     23476 (BRD4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    23476 (BRD4)
SSDB
Motif
Pfam: Bromodomain BET BRD4_CDT
Other DBs
NCBI-GeneID: 23476
NCBI-ProteinID: NP_490597
OMIM: 608749
HGNC: 13575
Ensembl: ENSG00000141867
Pharos: O60885(Tchem)
UniProt: O60885
Structure
Position
19:complement(15235519..15332539)
AA seq 1362 aa
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETE
MAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPP
PPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL
PQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPP
PPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP
HPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT
HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESI
KAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMG
SWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSM
LDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF
NT seq 4089 nt   +upstreamnt  +downstreamnt
atgtctgcggagagcggccctgggacgagattgagaaatctgccagtaatgggggatgga
ctagaaacttcccaaatgtctacaacacaggcccaggcccaaccccagccagccaacgca
gccagcaccaaccccccgcccccagagacctccaaccctaacaagcccaagaggcagacc
aaccaactgcaatacctgctcagagtggtgctcaagacactatggaaacaccagtttgca
tggcctttccagcagcctgtggatgccgtcaagctgaacctccctgattactataagatc
attaaaacgcctatggatatgggaacaataaagaagcgcttggaaaacaactattactgg
aatgctcaggaatgtatccaggacttcaacactatgtttacaaattgttacatctacaac
aagcctggagatgacatagtcttaatggcagaagctctggaaaagctcttcttgcaaaaa
ataaatgagctacccacagaagaaaccgagatcatgatagtccaggcaaaaggaagagga
cgtgggaggaaagaaacagggacagcaaaacctggcgtttccacggtaccaaacacaact
caagcatcgactcctccgcagacccagacccctcagccgaatcctcctcctgtgcaggcc
acgcctcaccccttccctgccgtcaccccggacctcatcgtccagacccctgtcatgaca
gtggtgcctccccagccactgcagacgcccccgccagtgcccccccagccacaaccccca
cccgctccagctccccagcccgtacagagccacccacccatcatcgcggccaccccacag
cctgtgaagacaaagaagggagtgaagaggaaagcagacaccaccacccccaccaccatt
gaccccattcacgagccaccctcgctgcccccggagcccaagaccaccaagctgggccag
cggcgggagagcagccggcctgtgaaacctccaaagaaggacgtgcccgactctcagcag
cacccagcaccagagaagagcagcaaggtctcggagcagctcaagtgctgcagcggcatc
ctcaaggagatgtttgccaagaagcacgccgcctacgcctggcccttctacaagcctgtg
gacgtggaggcactgggcctacacgactactgtgacatcatcaagcaccccatggacatg
agcacaatcaagtctaaactggaggcccgtgagtaccgtgatgctcaggagtttggtgct
gacgtccgattgatgttctccaactgctataagtacaaccctcctgaccatgaggtggtg
gccatggcccgcaagctccaggatgtgttcgaaatgcgctttgccaagatgccggacgag
cctgaggagccagtggtggccgtgtcctccccggcagtgccccctcccaccaaggttgtg
gccccgccctcatccagcgacagcagcagcgatagctcctcggacagtgacagttcgact
gatgactctgaggaggagcgagcccagcggctggctgagctccaggagcagctcaaagcc
gtgcacgagcagcttgcagccctctctcagccccagcagaacaaaccaaagaaaaaggag
aaagacaagaaggaaaagaaaaaagaaaagcacaaaaggaaagaggaagtggaagagaat
aaaaaaagcaaagccaaggaacctcctcctaaaaagacgaagaaaaataatagcagcaac
agcaatgtgagcaagaaggagccagcgcccatgaagagcaagccccctcccacgtatgag
tcggaggaagaggacaagtgcaagcctatgtcctatgaggagaagcggcagctcagcttg
gacatcaacaagctccccggcgagaagctgggccgcgtggtgcacatcatccagtcacgg
gagccctccctgaagaattccaaccccgacgagattgaaatcgactttgagaccctgaag
ccgtccacactgcgtgagctggagcgctatgtcacctcctgtttgcggaagaaaaggaaa
cctcaagctgagaaagttgatgtgattgccggctcctccaagatgaagggcttctcgtcc
tcagagtcggagagctccagtgagtccagctcctctgacagcgaagactccgaaacagag
atggctccgaagtcaaaaaagaaggggcaccccgggagggagcagaagaagcaccatcat
caccaccatcagcagatgcagcaggccccggctcctgtgccccagcagccgcccccgcct
ccccagcagcccccaccgcctccacctccgcagcagcaacagcagccgccacccccgcct
cccccaccctccatgccgcagcaggcagccccggcgatgaagtcctcgcccccacccttc
attgccacccaggtgcccgtcctggagccccagctcccaggcagcgtctttgaccccatc
ggccacttcacccagcccatcctgcacctgccgcagcctgagctgccccctcacctgccc
cagccgcctgagcacagcactccaccccatctcaaccagcacgcagtggtctctcctcca
gctttgcacaacgcactaccccagcagccatcacggcccagcaaccgagccgctgccctg
cctcccaagcccgcccggcccccagccgtgtcaccagccttgacccaaacacccctgctc
ccacagccccccatggcccaacccccccaagtgctgctggaggatgaagagccacctgcc
ccacccctcacctccatgcagatgcagctgtacctgcagcagctgcagaaggtgcagccc
cctacgccgctactcccttccgtgaaggtgcagtcccagcccccaccccccctgccgccc
ccaccccacccctctgtgcagcagcagctgcagcagcagccgccaccacccccaccaccc
cagccccagcctccaccccagcagcagcatcagccccctccacggcccgtgcacttgcag
cccatgcagttttccacccacatccaacagcccccgccaccccagggccagcagcccccc
catccgcccccaggccagcagccacccccgccgcagcctgccaagcctcagcaagtcatc
cagcaccaccattcaccccggcaccacaagtcggacccctactcaaccggtcacctccgc
gaagccccctccccgcttatgatacattccccccagatgtcacagttccagagcctgacc
caccagtctccaccccagcaaaacgtccagcctaagaaacaggagctgcgtgctgcctcc
gtggtccagccccagcccctcgtggtggtgaaggaggagaagatccactcacccatcatc
cgcagcgagcccttcagcccctcgctgcggccggagccccccaagcacccggagagcatc
aaggcccccgtccacctgccccagcggccggaaatgaagcctgtggatgtcgggaggcct
gtgatccggcccccagagcagaacgcaccgccaccaggggcccctgacaaggacaaacag
aaacaggagccgaagactccagttgcgcccaaaaaggacctgaaaatcaagaacatgggc
tcctgggccagcctagtgcagaagcatccgaccaccccctcctccacagccaagtcatcc
agcgacagcttcgagcagttccgccgcgccgctcgggagaaagaggagcgtgagaaggcc
ctgaaggctcaggccgagcacgctgagaaggagaaggagcggctgcggcaggagcgcatg
aggagccgagaggacgaggatgcgctggagcaggcccggcgggcccatgaggaggcacgt
cggcgccaggagcagcagcagcagcagcgccaggagcaacagcagcagcagcaacagcaa
gcagctgcggtggctgccgccgccaccccacaggcccagagctcccagccccagtccatg
ctggaccagcagagggagttggcccggaagcgggagcaggagcgaagacgccgggaagcc
atggcagctaccattgacatgaatttccagagtgatctattgtcaatatttgaagaaaat
cttttctga

DBGET integrated database retrieval system