KEGG   Homo sapiens (human): 23476
Entry
23476             CDS       T01001                                 

Gene name
BRD4, CAP, HUNK1, HUNKI, MCAP
Definition
(RefSeq) bromodomain containing 4
  KO
K11722  bromodomain-containing protein 4
Organism
hsa  Homo sapiens (human)
Drug target
Apabetalone: D11131
Birabresib: D10911
Mivebresib: D11479
Molibresib (DG02993): D11326 D11347
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23476 (BRD4)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    23476 (BRD4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23476 (BRD4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   23476 (BRD4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Brd4/P-TEFb complex
     23476 (BRD4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    23476 (BRD4)
SSDB
Motif
Pfam: Bromodomain BET BRD4_CDT SR-25 YL1
Other DBs
NCBI-GeneID: 23476
NCBI-ProteinID: NP_490597
OMIM: 608749
HGNC: 13575
Ensembl: ENSG00000141867
Vega: OTTHUMG00000183252
Pharos: O60885(Tchem)
UniProt: O60885
Structure
PDB: 
4QB3 6FO5 4ZC9 5EI4 4Z1S 6S25 5DW2 5KU3 6DMJ 5NNE 5NNF 5CFW 5WA5 6FNX 5WMG 5LJ2 4UIZ 6Q3Y 5NNG 4X2I 4NUD 6CD4 4J3I 6G0R 4PCI 4IOO 6E4A 5WMD 4Z93 6FT3 4QR4 4PCE 4LR6 6AJZ 6G0P 5O97 5VBO 4UIY 4NUE 4LYI 4CFL 4YH4 6FSY 6FT4 4O78 4O7A 5W55 5UF0 5F60 5F62 5E0R 4WHW 2OSS 5A5S 4O71 4UYD 4QR3 3UVW 6SE4 5M39 3U5L 6AJW 6G0O 6G0Q 5WMA 5I88 5HM0 4Z1Q 4PS5 4CL9 4O72 4NUC 4BW1 4IOR 4F3I 4QR5 5Z1S 5Z1T 5Y8C 4HXS 6AJV 5YOV 5I80 5F61 5F63 4QZS 4O74 6DJC 6DL2 6CZU 6CJ2 6G0S 5KHM 5XI4 5AD3 5D0C 4HXN 6IN1 6DML 6C7R 5YOU 5OWW 5OWM 5ULA 5KDH 5HCL 5D3L 5BT4 4O7B 4BW3 4KV1 4IOQ 4HXM 3ZYU 6CIS 6C7Q 5UEZ 5KJ0 4HXL 4DON 6CJ1 5UVX 4HXR 5N2M 5CY9 4O70 4O75 4O7C 4CFK 4C67 4WIV 6CD5 4UIX 4NQM 5H21 4BJX 4HBY 2NNU 6MH1 6AJY 5HQ5 5EIS 5CQT 4YH3 4CLB 4GPJ 4A9L 3U5J 3P5O 3MXF 5LUU 4HXK 6CKR 5Z1R 5Y93 5UES 5MKZ 5TI4 5CS8 5CPE 5COI 4HBX 5Z5U 5UVZ 5MLI 4HBV 4NR8 5M3A 5TI7 5TI2 5D24 4OGJ 2YEL 5Z5V 5UVU 4MR4 5VOM 5XI3 5UVT 4BW4 6CIY 4MR3 3SVG 5UOO 4HBW 6HDQ 5Z8G 5UEQ 5TI6 5TI3 5LRQ 5IGK 5DLZ 5D3H 5D3J 5D25 4O76 5VZS 5JWM 6CKS 5WUU 5A85 4MEO 4J0R 4OGI 4HXP 6MH7 5D3S 4ZW1 5Y8W 5F5Z 4HXO 5UEP 4MEQ 5V67 5CP5 6DUV 5Z8Z 5Z90 5U28 4O7F 3U5K 4MEN 5YQX 5NND 5D26 6FFD 5VBP 5TI5 4XY9 4LYS 5Y8Z 4J0S 6HOV 5UEO 5FBX 4O7E 4MEP 4LZR 5Y8Y 5UER 4C66 6CZV 6AJX 5Z9K 2OUO 5LJ1 5HQ7 5DLX 5Y1Y 5XI2 3UVX 4BW2 4E96 5D3T 5UEV 5OVB 5HQ6 5D3P 4LYW 5XHY 3SVF 5Z5T 5UVV 5U2E 5CRM 6Q3Z 6AFR 5Z8R 5Y94 4O77 4KV4 5AD2 5ACY 3UVY 4XYA 6MAU 5CRZ 5UVW 5UVS 5D3N 5HLS 5D3R 4LZS 5EGU 4LRG 5NNC 5UVY 5UEU 5UET 5UEX 5DX4 3UW9 2YEM 5UEY 5CTL 5U2F 5T35 6DNE 5U2C 6BOY 6BN7 6BN8 6BN9 6BNB 6MNL 5Z9C 6BNH 2ND1 2NCZ 2ND0 2N3K 2MJV 2LSP 2I8N

Position
19p13.12
AA seq 1362 aa
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETE
MAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPP
PPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL
PQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPP
PPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP
HPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT
HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESI
KAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMG
SWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSM
LDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF
NT seq 4089 nt   +upstreamnt  +downstreamnt
atgtctgcggagagcggccctgggacgagattgagaaatctgccagtaatgggggatgga
ctagaaacttcccaaatgtctacaacacaggcccaggcccaaccccagccagccaacgca
gccagcaccaaccccccgcccccagagacctccaaccctaacaagcccaagaggcagacc
aaccaactgcaatacctgctcagagtggtgctcaagacactatggaaacaccagtttgca
tggcctttccagcagcctgtggatgccgtcaagctgaacctccctgattactataagatc
attaaaacgcctatggatatgggaacaataaagaagcgcttggaaaacaactattactgg
aatgctcaggaatgtatccaggacttcaacactatgtttacaaattgttacatctacaac
aagcctggagatgacatagtcttaatggcagaagctctggaaaagctcttcttgcaaaaa
ataaatgagctacccacagaagaaaccgagatcatgatagtccaggcaaaaggaagagga
cgtgggaggaaagaaacagggacagcaaaacctggcgtttccacggtaccaaacacaact
caagcatcgactcctccgcagacccagacccctcagccgaatcctcctcctgtgcaggcc
acgcctcaccccttccctgccgtcaccccggacctcatcgtccagacccctgtcatgaca
gtggtgcctccccagccactgcagacgcccccgccagtgcccccccagccacaaccccca
cccgctccagctccccagcccgtacagagccacccacccatcatcgcggccaccccacag
cctgtgaagacaaagaagggagtgaagaggaaagcagacaccaccacccccaccaccatt
gaccccattcacgagccaccctcgctgcccccggagcccaagaccaccaagctgggccag
cggcgggagagcagccggcctgtgaaacctccaaagaaggacgtgcccgactctcagcag
cacccagcaccagagaagagcagcaaggtctcggagcagctcaagtgctgcagcggcatc
ctcaaggagatgtttgccaagaagcacgccgcctacgcctggcccttctacaagcctgtg
gacgtggaggcactgggcctacacgactactgtgacatcatcaagcaccccatggacatg
agcacaatcaagtctaaactggaggcccgtgagtaccgtgatgctcaggagtttggtgct
gacgtccgattgatgttctccaactgctataagtacaaccctcctgaccatgaggtggtg
gccatggcccgcaagctccaggatgtgttcgaaatgcgctttgccaagatgccggacgag
cctgaggagccagtggtggccgtgtcctccccggcagtgccccctcccaccaaggttgtg
gccccgccctcatccagcgacagcagcagcgatagctcctcggacagtgacagttcgact
gatgactctgaggaggagcgagcccagcggctggctgagctccaggagcagctcaaagcc
gtgcacgagcagcttgcagccctctctcagccccagcagaacaaaccaaagaaaaaggag
aaagacaagaaggaaaagaaaaaagaaaagcacaaaaggaaagaggaagtggaagagaat
aaaaaaagcaaagccaaggaacctcctcctaaaaagacgaagaaaaataatagcagcaac
agcaatgtgagcaagaaggagccagcgcccatgaagagcaagccccctcccacgtatgag
tcggaggaagaggacaagtgcaagcctatgtcctatgaggagaagcggcagctcagcttg
gacatcaacaagctccccggcgagaagctgggccgcgtggtgcacatcatccagtcacgg
gagccctccctgaagaattccaaccccgacgagattgaaatcgactttgagaccctgaag
ccgtccacactgcgtgagctggagcgctatgtcacctcctgtttgcggaagaaaaggaaa
cctcaagctgagaaagttgatgtgattgccggctcctccaagatgaagggcttctcgtcc
tcagagtcggagagctccagtgagtccagctcctctgacagcgaagactccgaaacagag
atggctccgaagtcaaaaaagaaggggcaccccgggagggagcagaagaagcaccatcat
caccaccatcagcagatgcagcaggccccggctcctgtgccccagcagccgcccccgcct
ccccagcagcccccaccgcctccacctccgcagcagcaacagcagccgccacccccgcct
cccccaccctccatgccgcagcaggcagccccggcgatgaagtcctcgcccccacccttc
attgccacccaggtgcccgtcctggagccccagctcccaggcagcgtctttgaccccatc
ggccacttcacccagcccatcctgcacctgccgcagcctgagctgccccctcacctgccc
cagccgcctgagcacagcactccaccccatctcaaccagcacgcagtggtctctcctcca
gctttgcacaacgcactaccccagcagccatcacggcccagcaaccgagccgctgccctg
cctcccaagcccgcccggcccccagccgtgtcaccagccttgacccaaacacccctgctc
ccacagccccccatggcccaacccccccaagtgctgctggaggatgaagagccacctgcc
ccacccctcacctccatgcagatgcagctgtacctgcagcagctgcagaaggtgcagccc
cctacgccgctactcccttccgtgaaggtgcagtcccagcccccaccccccctgccgccc
ccaccccacccctctgtgcagcagcagctgcagcagcagccgccaccacccccaccaccc
cagccccagcctccaccccagcagcagcatcagccccctccacggcccgtgcacttgcag
cccatgcagttttccacccacatccaacagcccccgccaccccagggccagcagcccccc
catccgcccccaggccagcagccacccccgccgcagcctgccaagcctcagcaagtcatc
cagcaccaccattcaccccggcaccacaagtcggacccctactcaaccggtcacctccgc
gaagccccctccccgcttatgatacattccccccagatgtcacagttccagagcctgacc
caccagtctccaccccagcaaaacgtccagcctaagaaacaggagctgcgtgctgcctcc
gtggtccagccccagcccctcgtggtggtgaaggaggagaagatccactcacccatcatc
cgcagcgagcccttcagcccctcgctgcggccggagccccccaagcacccggagagcatc
aaggcccccgtccacctgccccagcggccggaaatgaagcctgtggatgtcgggaggcct
gtgatccggcccccagagcagaacgcaccgccaccaggggcccctgacaaggacaaacag
aaacaggagccgaagactccagttgcgcccaaaaaggacctgaaaatcaagaacatgggc
tcctgggccagcctagtgcagaagcatccgaccaccccctcctccacagccaagtcatcc
agcgacagcttcgagcagttccgccgcgccgctcgggagaaagaggagcgtgagaaggcc
ctgaaggctcaggccgagcacgctgagaaggagaaggagcggctgcggcaggagcgcatg
aggagccgagaggacgaggatgcgctggagcaggcccggcgggcccatgaggaggcacgt
cggcgccaggagcagcagcagcagcagcgccaggagcaacagcagcagcagcaacagcaa
gcagctgcggtggctgccgccgccaccccacaggcccagagctcccagccccagtccatg
ctggaccagcagagggagttggcccggaagcgggagcaggagcgaagacgccgggaagcc
atggcagctaccattgacatgaatttccagagtgatctattgtcaatatttgaagaaaat
cttttctga

DBGET integrated database retrieval system