KEGG   Homo sapiens (human): 23478
Entry
23478             CDS       T01001                                 

Gene name
SEC11A, 1810012E07Rik, SEC11L1, SPC18, SPCS4A, sid2895
Definition
(RefSeq) SEC11 homolog A, signal peptidase complex subunit
  KO
K13280  signal peptidase I [EC:3.4.21.89]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    23478 (SEC11A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    23478 (SEC11A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     23478 (SEC11A)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   23478 (SEC11A)
SSDB
Motif
Pfam: Peptidase_S24 Peptidase_S26
Other DBs
NCBI-GeneID: 23478
NCBI-ProteinID: NP_055115
OMIM: 618258
HGNC: 17718
Ensembl: ENSG00000140612
Vega: OTTHUMG00000172489
Pharos: P67812(Tbio)
UniProt: P67812 A0A024RC78
Position
15q25.2-q25.3
AA seq 179 aa
MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPA
FHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAV
DDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE
NT seq 540 nt   +upstreamnt  +downstreamnt
atgctgtctctagactttttggacgatgtgcggcggatgaacaagcggcagctctattat
caagtcctaaattttggaatgattgtctcatcggcactaatgatctggaaggggttaatg
gtaataactggaagtgaaagtccgattgtagtggtgctcagtggcagcatggaacctgca
tttcatagaggagatcttctctttctaacaaatcgagttgaagatcccatacgagtggga
gaaattgttgtttttaggatagaaggaagagagattcctatagttcaccgagtcttgaag
attcatgaaaagcaaaatgggcatatcaagtttttgaccaaaggagataataatgcggtt
gatgaccgaggcctctataaacaaggacaacattggctagagaaaaaagatgttgtgggg
agagccaggggatttgttccttatattggaattgtgacgatcctcatgaatgactatcct
aaatttaagtatgcagttctctttttgctgggtttattcgtgctggttcatcgtgagtaa

DBGET integrated database retrieval system