KEGG   Homo sapiens (human): 2348Help
Entry
2348              CDS       T01001                                 

Gene name
FOLR1, FBP, FOLR, FRalpha
Definition
(RefSeq) folate receptor alpha
  KO
K13649  folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04144  Endocytosis
Disease
H01295  Neurodegeneration due to cerebral folate transport deficiency
Drug target
Farletuzumab: D09343
Mirvetuximab: D10953
Mirvetuximab soravtansine: D10954
Vintafolide: D10434
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2348 (FOLR1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    2348 (FOLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2348 (FOLR1)
   04147 Exosome [BR:hsa04147]
    2348 (FOLR1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2348 (FOLR1)
Transporters [BR:hsa02000]
 Other transporters
  Others
   2348 (FOLR1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2348 (FOLR1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2348 (FOLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_rec
Motif
Other DBs
NCBI-GeneID: 2348
NCBI-ProteinID: NP_000793
OMIM: 136430
HGNC: 3791
Ensembl: ENSG00000110195
Vega: OTTHUMG00000167876
Pharos: P15328(Tchem)
UniProt: P15328 A0A024R5H1
Structure
PDB: 

Position
11q13.4
AA seq 257 aa AA seqDB search
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcggatgacaacacagctgctgctccttctagtgtgggtggctgtagtaggg
gaggctcagacaaggattgcatgggccaggactgagcttctcaatgtctgcatgaacgcc
aagcaccacaaggaaaagccaggccccgaggacaagttgcatgagcagtgtcgaccctgg
aggaagaatgcctgctgttctaccaacaccagccaggaagcccataaggatgtttcctac
ctatatagattcaactggaaccactgtggagagatggcacctgcctgcaaacggcatttc
atccaggacacctgcctctacgagtgctcccccaacttggggccctggatccagcaggtg
gatcagagctggcgcaaagagcgggtactgaacgtgcccctgtgcaaagaggactgtgag
caatggtgggaagattgtcgcacctcctacacctgcaagagcaactggcacaagggctgg
aactggacttcagggtttaacaagtgcgcagtgggagctgcctgccaacctttccatttc
tacttccccacacccactgttctgtgcaatgaaatctggactcactcctacaaggtcagc
aactacagccgagggagtggccgctgcatccagatgtggttcgacccagcccagggcaac
cccaatgaggaggtggcgaggttctatgctgcagccatgagtggggctgggccctgggca
gcctggcctttcctgcttagcctggccctaatgctgctgtggctgctcagctga

DBGET integrated database retrieval system