KEGG   Homo sapiens (human): 23481
Entry
23481             CDS       T01001                                 

Gene name
PES1, NOP7, PES
Definition
(RefSeq) pescadillo ribosomal biogenesis factor 1
  KO
K14843  pescadillo
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    23481 (PES1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    23481 (PES1)
SSDB
Motif
Pfam: Pescadillo_N BRCT_2 BRCT
Other DBs
NCBI-GeneID: 23481
NCBI-ProteinID: NP_055118
OMIM: 605819
HGNC: 8848
Ensembl: ENSG00000100029
Vega: OTTHUMG00000151077
Pharos: O00541(Tbio)
UniProt: O00541 B2RDF2
Structure
PDB: 
2EP8

Position
22q12.2
AA seq 588 aa
MGGLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTA
ARTFYLIKDIRFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHII
KERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFMHYIIAARALRK
VFLSIKGIYYQAEVLGQPIVWITPYAFSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQ
LLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEF
PTDGEMSAQEEDRRKELEAQEKHKKLFEGLKFFLNREVPREALAFIIRSFGGEVSWDKSL
CIGATYDVTDSRITHQIVDRPGQQTSVIGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLP
PHLSPFVTEKEGDYVPPEKLKLLALQRGEDPGNLNESEEEEEEDDNNEGDGDEEGENEEE
EEDAEAGSEKEEEARLAALEEQRMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMM
KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgggaggccttgagaagaagaagtatgaacgaggctcggccaccaactacatcacccgg
aacaaagcccggaagaagctccagctgagcttggctgactttaggcggctgtgcattctg
aagggcatttatccccatgaacccaaacacaagaagaaggttaacaagggttctacagca
gcccgaacgttttaccttatcaaagacatcaggtttctcctccacgaacccattgtcaac
aagttccgtgaatacaaggtgttcgtccggaagctccggaaggcttatgggaagagcgag
tggaacactgtagagcgtttaaaggacaataagcccaactacaaactcgaccacatcatc
aaggaacggtatcccacgttcatcgatgccctgcgggacctggacgatgccctctccatg
tgcttcctgttttccaccttcccgcggactggcaagtgccacgtgcagaccattcagctg
tgccgccggctcactgtggagttcatgcactacattatcgctgcccgtgccctgcgcaag
gtcttcctgtccatcaaaggcatttactaccaggccgaggtactggggcagcccatcgtg
tggatcactccctatgccttctcccatgaccacccgacagacgtggactacagggtcatg
gccaccttcaccgagttctacaccacgctgctgggctttgtcaacttccgcctttaccag
ttgctcaacctccactatcccccgaagctcgagggtcaggcccaagcagaggcaaaggcc
ggtgagggcacctacgcgttggactccgagagttgtatggagaaactggcagccctcagt
gccagcctggcccgcgtggtggtgcctgccacagaggaggaggccgaggtggatgagttt
cccaccgatggggagatgtcagcgcaggaggaagaccgcaggaaggagctggaggcgcag
gagaagcacaagaagctttttgagggcctgaagttcttcctgaaccgagaggtgccccgt
gaggccctggccttcatcatcaggagttttggtggggaagtgtcctgggacaaatctttg
tgcattggggccacctatgacgtcacagactcccgcatcacccatcagattgtcgaccgg
cctgggcagcagacctcagtcattggcaggtgctacgtgcagccccagtgggtgtttgac
tcagtgaacgccaggctccttctccccgtggcagagtacttctctggggtgcagctgccc
ccacacctttcaccctttgtgaccgagaaggaaggagattacgttccacctgagaagctg
aagctgctggctctgcagcggggagaggacccaggaaacctgaatgagtcagaagaggag
gaggaagaggacgacaacaacgaaggtgatggtgatgaagagggagaaaatgaggaggag
gaggaagatgcagaggctggttcagaaaaggaggaagaggcccggctggcagccctggaa
gagcagaggatggaggggaagaagcccagggtgatggcaggcaccttgaagctggaggat
aagcagcggctggcccaggaggaggagagtgaggccaagcgcctggccattatgatgatg
aagaagcgggagaagtacctgtaccagaagatcatgtttggcaagaggcgaaaaatccga
gaggccaacaagctggcggagaagcggaaagcccacgatgaggcggtgaggtctgagaag
aaggccaagaaggcaaggccggagtga

DBGET integrated database retrieval system