KEGG   Homo sapiens (human): 23492Help
Entry
23492             CDS       T01001                                 

Gene name
CBX7
Definition
(RefSeq) chromobox 7
  KO
K11454  chromobox protein 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23492 (CBX7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     23492 (CBX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo CBX7_C Mtf2_C
Motif
Other DBs
NCBI-GeneID: 23492
NCBI-ProteinID: NP_783640
OMIM: 608457
HGNC: 1557
Ensembl: ENSG00000100307
Vega: OTTHUMG00000150418
Pharos: O95931(Tchem)
UniProt: O95931 A0A024R1Q2
Structure
PDB: 

Position
22q13.1
AA seq 251 aa AA seqDB search
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtcagccatcggcgagcaggtgttcgccgtggagagcatccggaagaagcgc
gtgcggaagggtaaagtcgagtatctggtgaagtggaaaggatggcccccaaagtacagc
acgtgggagccagaagagcacatcttggacccccgcctcgtcatggcctacgaggagaag
gaggagagagaccgagcatcggggtataggaagagaggtccgaaacccaagcggcttctg
ctgcagcggctgtacagcatggacctgcggagctcccacaaggccaagggcaaggagaag
ctctgcttctccctgacgtgcccactcggcagcgggagccctgagggggtggtcaaggcg
ggggcacctgagctggtggacaagggccccttggtgcccaccctgcccttcccgctccgc
aagccccgaaaggcccacaagtacctgcggctctcgcgcaagaagttcccgccccgcggg
cccaacctggagagccacagccatcgacgggagctcttcctgcaggagccaccggcccca
gacgtcctgcaggcggctggcgagtgggagcctgctgcgcagccccctgaagaggaggca
gatgccgacctggccgaggggccccctccctggacacctgcgctcccctcaagtgaggtg
accgtgaccgacatcaccgccaactccatcaccgtcaccttccgcgaggcccaggcagct
gagggcttcttccgagaccgcagtgggaagttctga

DBGET integrated database retrieval system