KEGG   Homo sapiens (human): 23495Help
Entry
23495             CDS       T01001                                 

Gene name
TNFRSF13B, CD267, CVID, CVID2, IGAD2, RYZN, TACI, TNFRSF14B
Definition
(RefSeq) TNF receptor superfamily member 13B
  KO
K05150  tumor necrosis factor receptor superfamily member 13B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04672  Intestinal immune network for IgA production
hsa05340  Primary immunodeficiency
Disease
H00088  Common variable immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    23495 (TNFRSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    23495 (TNFRSF13B)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    23495 (TNFRSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    23495 (TNFRSF13B)
   04090 CD molecules [BR:hsa04090]
    23495 (TNFRSF13B)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   23495 (TNFRSF13B)
CD molecules [BR:hsa04090]
 Proteins
  23495 (TNFRSF13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TACI-CRD2 BCMA-Tall_bind BaffR-Tall_bind
Motif
Other DBs
NCBI-GeneID: 23495
NCBI-ProteinID: NP_036584
OMIM: 604907
HGNC: 18153
Ensembl: ENSG00000240505
Vega: OTTHUMG00000059262
Pharos: O14836(Tbio)
UniProt: O14836 Q4ACX1
Structure
PDB: 

Position
17p11.2
AA seq 293 aa AA seqDB search
MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQR
TCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR
QRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLV
AVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAP
TQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctgggccggagcaggcgaggtggccggagccgtgtggaccaggaggagcgc
tttccacagggcctgtggacgggggtggctatgagatcctgccccgaagagcagtactgg
gatcctctgctgggtacctgcatgtcctgcaaaaccatttgcaaccatcagagccagcgc
acctgtgcagccttctgcaggtcactcagctgccgcaaggagcaaggcaagttctatgac
catctcctgagggactgcatcagctgtgcctccatctgtggacagcaccctaagcaatgt
gcatacttctgtgagaacaagctcaggagcccagtgaaccttccaccagagctcaggaga
cagcggagtggagaagttgaaaacaattcagacaactcgggaaggtaccaaggattggag
cacagaggctcagaagcaagtccagctctcccggggctgaagctgagtgcagatcaggtg
gccctggtctacagcacgctggggctctgcctgtgtgccgtcctctgctgcttcctggtg
gcggtggcctgcttcctcaagaagaggggggatccctgctcctgccagccccgctcaagg
ccccgtcaaagtccggccaagtcttcccaggatcacgcgatggaagccggcagccctgtg
agcacatcccccgagccagtggagacctgcagcttctgcttccctgagtgcagggcgccc
acgcaggagagcgcagtcacgcctgggacccccgaccccacttgtgctggaaggtggggg
tgccacaccaggaccacagtcctgcagccttgcccacacatcccagacagtggccttggc
attgtgtgtgtgcctgcccaggaggggggcccaggtgcataa

DBGET integrated database retrieval system