KEGG   Homo sapiens (human): 23498
Entry
23498             CDS       T01001                                 

Gene name
HAAO, 3-HAO, HAO, VCRL1, h3HAO
Definition
(RefSeq) 3-hydroxyanthranilate 3,4-dioxygenase
  KO
K00452  3-hydroxyanthranilate 3,4-dioxygenase [EC:1.13.11.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
hsa_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Disease
H02087  Vertebral, cardiac, renal, and limb defects syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    23498 (HAAO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.6  3-hydroxyanthranilate 3,4-dioxygenase
     23498 (HAAO)
SSDB
Motif
Pfam: 3-HAO Cupin_2 AraC_binding Cupin_1
Other DBs
NCBI-GeneID: 23498
NCBI-ProteinID: NP_036337
OMIM: 604521
HGNC: 4796
Ensembl: ENSG00000162882
Vega: OTTHUMG00000152348
Pharos: P46952(Tbio)
UniProt: P46952
Structure
PDB: 
2QNK 5TKQ 5TK5

Position
2p21
AA seq 286 aa
MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEG
DMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYV
GDTMDVLFEKWFYCKDLGTQLAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEP
MSLDAWLDSHHRELQAGTPLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVT
MGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG
NT seq 861 nt   +upstreamnt  +downstreamnt
atggagcgccgcctgggagtgagggcctgggtgaaggagaaccggggctccttccagccc
ccggtctgcaacaagctcatgcaccaggagcagctcaaagtcatgttcatcggaggcccc
aacaccaggaaggactatcacatcgaagagggtgaagaggtattttaccagctggaggga
gacatggttctccgagtcctggagcaagggaaacaccgggatgtggtcattcggcaggga
gagatattcctcctgcctgccagggtgccccactcaccacagaggtttgccaacaccgtg
gggctggtggttgagcgaaggcggctggagaccgagctagatgggctcaggtactatgtg
ggcgacaccatggacgttctgtttgagaagtggttctactgcaaggacctcggcacgcag
ttggcccccatcatccaggagttcttcagctctgagcagtacagaacaggaaagcccatc
cctgaccagctgctcaaggagccaccattccctctgagcacacgatccatcatggagccc
atgtccctggatgcctggctggacagccaccacagggagctgcaggcaggcacaccactc
agcctgtttggggacacctatgagacccaggtgatcgcctatgggcaaggcagcagcgaa
ggcctgagacagaatgtggacgtgtggctgtggcagctggagggctcctcggtggtgaca
atggggggacggcgcctgagcctggcccctgatgacagcctcctggtgctagctgggacc
tcgtatgcctgggagcgaacacaaggctctgtggccctgtctgtgacccaggaccctgcc
tgcaagaagcccctggggtga

DBGET integrated database retrieval system