KEGG   Homo sapiens (human): 23499Help
Entry
23499             CDS       T01001                                 

Gene name
MACF1, ABP620, ACF7, LIS9, MACF, OFC4
Definition
(RefSeq) microtubule actin crosslinking factor 1
  KO
K19827  microtuble-actin crosslinking factor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23499 (MACF1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     23499 (MACF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH GAS2 Spectrin_like SH3_10 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 CAMSAP_CH Laminin_II DotA
Motif
Other DBs
NCBI-GeneID: 23499
NCBI-ProteinID: NP_036222
OMIM: 608271
HGNC: 13664
Ensembl: ENSG00000127603
Vega: OTTHUMG00000007754
Pharos: Q9UPN3(Tbio)
UniProt: Q9UPN3 Q6ZSD7
Structure
PDB: 

Position
1p34.3
AA seq 5430 aa AA seqDB search
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELKALYNQYIHFK
ETEILAKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLR
PAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQEC
EGLIRQLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPP
STLTTTHLKAEPLTKATHSSSTSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQ
MKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYAETLGK
LETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNSNISAKRN
YFSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQ
HVKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQ
SKSSVASLVGRSKTIVQLKPRSPDHVLKNTISVKAVCDYRQIEITICKNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISW
NYLRKDLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEE
EVEACKARFQHLMKSMENEDKEETVAKMYISELKNIRLRLEEYEQRVVKRIQSLASSRTD
RDAWQDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVE
KMDHVYGLSTVYLNKLKTVDVIVRSIQDAELLVKGYEIKLSQEEVVLADLSALEAHWSTL
RHWLSDVKDKNSVFSVLDEEIAKAKVVAEQMSRLTPERNLDLERYQEKGSQLQERWHRVI
AQLEIRQSELESIQEVLGDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQT
ALFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDA
ITQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVST
LARNTQGKATSSETKESTDIEKAILEQQVLSEELTTKKEQVSEAIKTSQIFLAKHGHKLS
EKEKKQISEQLNALNKAYHDLCDGSANQLQQLQSQLAHQTEQKTLQKQQNTCHQQLEDLC
SWVGQAERALAGHQGRTTQQDLSALQKNQSDLKDLQDDIQNRATSFATVVKDIEGFMEEN
QTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELEEAVTSALQQETEKSKAAKELAE
NKKKIDALLDWVTSVGSSGGQLLTNLPGMEQLSGASLEKGALDTTDGYMGVNQAPEKLDK
QCEMMKARHQELLSQQQNFILATQSAQAFLDQHGHNLTPEEQQMLQQKLGELKEQYSTSL
AQSEAELKQVQTLQDELQKFLQDHKEFESWLERSEKELENMHKGGSSPETLPSLLKRQGS
FSEDVISHKGDLRFVTISGQKVLDMENSFKEGKEPSEIGNLVKDKLKDATERYTALHSKC
TRLGSHLNMLLGQYHQFQNSADSLQAWMQACEANVEKLLSDTVASDPGVLQEQLATTKQL
QEELAEHQVPVEKLQKVARDIMEIEGEPAPDHRHVQETTDSILSHFQSLSYSLAERSSLL
QKAIAQSQSVQESLESLLQSIGEVEQNLEGKQVSSLSSGVIQEALATNMKLKQDIARQKS
SLEATREMVTRFMETADSTTAAVLQGKLAEVSQRFEQLCLQQQEKESSLKKLLPQAEMFE
HLSGKLQQFMENKSRMLASGNQPDQDITHFFQQIQELNLEMEDQQENLDTLEHLVTELSS
CGFALDLCQHQDRVQNLRKDFTELQKTVKEREKDASSCQEQLDEFRKLVRTFQKWLKETE
GSIPPTETSMSAKELEKQIEHLKSLLDDWASKGTLVEEINCKGTSLENLIMEITAPDSQG
KTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLHERQESLQAILNRM
EEVHKEANSVLQWLESKEEVLKSMDAMSSPTKTETVKAQAESNKAFLAELEQNSPKIQKV
KEALAGLLVTYPNSQEAENWKKIQEELNSRWERATEVTVARQRQLEESASHLACFQAAES
QLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILTG
PGDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVRAV
GQRLSVQSAISTQPEAVKQQLEETSEIRSDLEQLDHEVKEAQTLCDELSVLIGEQYLKDE
LKKRLETVALPLQGLEDLAADRINRLQAALASTQQFQQMFDELRTWLDDKQSQQAKNCPI
SAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVELKN
HWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWIEDCKAKMSELRVTLDPVQLESSL
LRSKAMLNEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQNMDAVTEELQAKT
GSLEEMTQRLREFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQAL
EPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEFLEVKQRVNSGCVMMENKLEGIG
QFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIHVLKLDIEASEAE
CRHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQEQLELTLGRVEDFYRKLKGLND
ATTAAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGK
DCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELI
ANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQL
ESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTA
KIQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTSPAEQGVLSEKIDSLQARYSEIQ
DRCCRKAALLDQALSNARLFGEDEVEVLNWLAEVEDKLSSVFVKDFKQDVLHRQHADHLA
LNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLE
QARQLATKFQSTYEELTGWLREVEEELATSGGQSPTGEQIPQFQQRQKELKKEVMEHRLV
LDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQ
AADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEI
FGTCGEEQKTVLQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEE
TRALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGEMV
EEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQITEFHDKIEPMLETLENLSSRLRMPP
LIPAEVDKIRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKL
DQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPS
IIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLN
KTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKE
FKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKL
EGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQA
TVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFH
SEIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRL
MLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWL
TLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDV
VLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSEL
EISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPEDSQKLDNFLGEV
RDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVM
NLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSV
SKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKK
VEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALS
ELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVD
RVTKTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQ
VWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQD
GKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTD
ADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMAL
DEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSA
SQSNHSCTSMPSSPATPASGTKVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGA
KTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGN
SRRGLNKPSKIPTMSKKTTTASPRTPGPKR
NT seq 16293 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctcagatgaagagacgctcagtgagcggtcatgtcggagtgagcggtcttgt
cggagtgagcgatcttacaggagcgagcggtcggggagcctgtctccctgtcccccaggg
gacaccttgccctggaacctgccactgcatgagcagaaaaagcggaaaagccaggattcg
gtgctggaccctgcagagcgtgctgtggtcagagtcgctgatgaacgggaccgggttcag
aagaaaacgttcaccaagtgggtcaacaagcacttaatgaaggtccgcaagcacatcaat
gatctttatgaagatctgcgggatggccataacctgatctctctgttggaggtcctctca
ggcatcaaactgccccgggagaagggcaggatgcgttttcataggctgcagaatgtgcag
attgccctggacttcctaaagcagcgacaggtgaaactagtgaatattcgcaatgatgac
atcacagatggcaaccccaagttgaccctgggtctgatctggaccattattttgcatttc
cagatctctgacatctacattagtggagaatcaggggatatgtcagccaaggagaaacta
ctcctgtggacccagaaggtgacagctggttacacaggaatcaaatgcaccaacttttcc
tcctgctggagtgatgggaagatgttcaatgcactcattcaccgataccgacccgatcta
gtagacatggagagggtgcaaatccaaagtaaccgagagaatctggaacaggcttttgaa
gtggcagaaagactgggggtcactcgcctgctggatgcagaagatgtggatgtgccatct
ccagatgaaaagtctgtaatcacttatgtgtcttcgatttatgatgccttccctaaagtt
cctgagggtggagaagggatcagtgctacggaagtggactccaggtggcaagaataccaa
agccgagtggactccctcattccctggatcaaacagcatacaatactgatgtcagataaa
acttttccccaaaaccctgttgaactaaaggcactttataaccaatatatacacttcaaa
gaaacagaaattctggccaaggagagagaaaaaggaagaattgaggaattatataaatta
ctagaggtgtggattgaatttggccgaattaaactgcctcaaggttatcaccctaatgat
gtggaagaagagtggggaaagctcatcatagagatgctggaacgagagaaatcacttcgg
ccggctgtggagaggctggaattgctgctacagattgcaaacaaaatccagaatggtgct
ttgaactgtgaagaaaaactgacactagctaagaatacactgcaggctgatgctgctcac
ctggaatcaggacaaccggtacaatgtgagtcagatgtcattatgtacattcaggagtgt
gaaggtctcatcaggcagctgcaggtggatctccagatcctgcgggatgagaattactac
cagctagaagagctggcttttagggtcatgcgtcttcaggatgagctggtcaccttgcgt
ctagagtgtacaaacctgtaccggaagggtcatttcacttcacttgaattggttccaccc
tctactttaaccaccactcatctgaaagcagaacccttaaccaaggcaacccattcttct
tctacctcctggttccgaaagcctatgactcgggctgaacttgtggccatcagctcctct
gaagatgaaggcaatctccgatttgtgtatgaactactgtcttgggtagaagagatgcag
atgaaactggagcgagcagagtggggcaatgacctgcctagtgtggagttgcagctagaa
acacagcagcacatccatacgagtgtagaagagctgggctcaagtgtcaaggaggccagg
ttgtatgagggaaagatgtcccagaatttccataccagctatgctgaaactcttggaaag
ctggagacacagtattgtaaattgaaggaaacttctagcttccggatgaggcaccttcag
agcctgcataaatttgtttccagagctacagctgagttgatctggttgaatgagaaggag
gaggaggaactagcatatgactggagtgacaacaattccaatatctcagccaagagaaat
tacttctctgagttgacaatggaactggaggagaaacaggatgtgtttcgttctctacaa
gatacagcagaactactttcacttgagaaccacccagccaagcagacagtggaggcttac
agtgctgctgtccagtcccagttgcagtggatgaagcagctgtgcctgtgtgttgagcag
catgtgaaagagaatactgcttattttcagttcttcagtgatgcacgagagctggagtca
ttcttgaggaacctccaagattccattaaacgaaaatattcctgtgaccacaacaccagc
ttatcccgccttgaagacctgctccaggactccatggatgaaaaggagcagcttatacag
tccaagagttccgttgccagtctcgttgggagatcaaaaaccatcgttcagctaaaacca
cgcagtccagaccatgtgttaaagaacaccatttctgtcaaggctgtctgtgactacagg
cagatcgagattactatttgcaaaaatgatgaatgtgtgctagaagataattctcagcgg
accaaatggaaagtgatcagccccacagggaacgaggcaatggtgccgtcagtctgcttc
ctcatccccccacccaataaggatgccattgagatggccagcagggtcgaacaatcttat
cagaaggttatggccctttggcatcagctgcatgttaacaccaaaagccttatctcttgg
aactatctgcgtaaagaccttgaccttgtacagacctggaacctagaaaagcttcgatcc
tcagcaccaggggagtgccatcagattatgaagaaccttcaggcccactatgaagacttt
ctgcaggatagtcgtgactctgtgctgttctcagtggctgatcgcttgcgcttggaagag
gaggtggaagcttgtaaagcccgcttccagcacctgatgaagtccatggagaatgaggac
aaagaggagactgtggccaagatgtacatttcagagttgaagaacatccggctacgcctg
gaggagtatgaacagagggtggtcaaacgaattcagtctctagccagctctaggactgac
agagatgcctggcaggacaatgcattaaggattgcagagcaagagcacacccaggaggat
ttacagcaattgaggtcagacttggatgcagtttctatgaaatgtgacagctttctccat
cagtctccatctagttcaagtgtcccaactctgcgctcagaactgaatctgctggtggag
aagatggaccatgtctatggtctctctactgtatatctgaataagttaaagacagttgat
gttatagtacgtagcatacaggatgctgaactcttggtcaaaggttatgagattaagctg
agtcaagaagaagtagtactggcagatctctcagctctggaggcccattggtcgacatta
cggcactggcttagtgatgtgaaggacaagaattcagtgttttcagtcctggatgaggaa
attgccaaggccaaggtagtggcagagcagatgagtcgtctgacaccagagcgaaatctg
gatttggagcgctatcaggaaaaaggctcccagctgcaggagcgttggcaccgagtcatt
gcccagctcgagattcgccaatctgagctagaaagtatccaggaagttctgggagattac
cgagcctgccatggaactctcatcaagtggattgaggaaaccactgcccagcaggaaatg
atgaagccaggccaggcagaggatagcagagtgctttcggagcagctcagccagcagacg
gccctatttgcagaaattgagagaaatcagacaaaactggatcaatgtcaaaaattttcc
cagcagtactctactattgtaaaggactatgaattgcaactgatgacatacaaggccttt
gtggaatcgcagcagaaatcccctggcaagcgccgtcgcatgctttcctcttcagatgcc
atcactcaagagttcatggacttaaggactcgctacacggcattggtgactttaacaact
cagcacgtgaaatacatcagtgatgcactccggcgtctggaggaggaggagaaagtggta
gaagaggagaaacaagaacatgtggagaaggttaaagaacttttgggctgggtgtctacc
ctagcgaggaatacacaaggaaaagctacctcatccgagaccaaagaatcaacagacatt
gaaaaagctattttggaacagcaggttctgtcagaagagctgacaacaaagaaagaacaa
gtctctgaagctattaaaacatcacagatcttcttggccaagcatggtcataagctctca
gaaaaagagaagaaacaaatatctgagcaattgaatgccctaaacaaggcttaccatgac
ctttgtgatggttctgcaaatcagcttcagcagcttcagagccagttggctcaccagaca
gaacaaaagaccctgcagaaacaacaaaatacctgtcaccagcaactggaggatctttgc
agttgggtaggacaggcagaaagagcactggcaggccaccaaggcagaaccacccagcag
gatctctctgctttgcagaagaaccaaagtgacttgaaggatttacaggatgacattcag
aatcgtgccacctcatttgccactgttgtcaaggacattgaggggttcatggaagagaat
cagaccaagctgagcccacgtgagttgacagctcttcgggaaaagcttcatcaggctaag
gagcaatatgaggcgctccaggaagagacacgtgtggcccagaaggaactggaggaagca
gtgacctccgccttacagcaggagactgaaaagagtaaagcagcaaaggaactggcagag
aacaagaagaagatcgatgctctcctggattgggtaacttcagtaggatcatctggtgga
cagctgctgaccaaccttccaggaatggagcagctctcgggagctagcttggagaaagga
gccttggacaccactgatggttacatgggggtgaatcaagccccagagaaactggacaag
caatgtgagatgatgaaggcccgtcaccaagaattgctgtcccagcagcaaaatttcatt
ctggccacccagtcagctcaggccttcttggatcagcatggccacaatctcacacctgag
gagcaacagatgctgcaacagaagctgggagagctaaaggaacaatactctacttccctg
gcccaatcagaggcagaactgaagcaggtgcagacacttcaggatgagttgcagaaattt
ctgcaggatcataaagagtttgaaagctggttggaacgatccgagaaagagctggagaac
atgcataagggaggcagcagccccgagacccttccctccctgctaaagcggcaaggaagc
ttctcagaggatgtcatttcccacaaaggagacttgagatttgtgactatctcaggacag
aaagtcttggacatggaaaacagttttaaggaaggcaaagaaccatcagaaattggaaac
ttagtaaaggacaagttgaaggatgcaacagaaagatacactgctctccactcaaagtgt
acacgattaggatctcacctgaatatgctgttaggccagtatcatcaattccaaaacagt
gctgacagcctgcaggcctggatgcaggcttgtgaggccaacgtggagaagctcctctca
gatactgttgcctctgaccctggagttctccaggagcagcttgcaacaacaaagcagttg
caggaggaattggctgagcaccaagtacctgtggaaaaactccaaaaagtagctcgtgac
ataatggaaattgaaggggagccagccccagaccacaggcatgttcaagaaactacagat
tccatactcagccacttccaaagcctctcctatagcctggctgagcgatcttctctgctg
cagaaagcaattgcccaatctcagagtgtccaggaaagcctggagagcctgttgcagtct
attggggaagttgaacaaaacctggaagggaagcaggtgtcatcactctcatcaggagtc
atccaggaagccttagccacaaatatgaaattgaagcaggacattgctcggcaaaagagc
agcttggaggccacccgtgagatggtgacccgattcatggagacagcagacagtactaca
gcagcagtgctgcagggcaaactggcagaggtgagccagcggttcgaacagctctgtcta
cagcagcaagaaaaggagagctccctaaagaagcttctaccccaggcagagatgtttgaa
cacctctctggtaagctgcagcagttcatggaaaacaaaagtcggatgctggcctctgga
aatcagccagatcaagatattacacatttcttccaacagatccaggagctcaatttggaa
atggaagaccaacaggagaacctagatactcttgagcacctggtcactgaactgagctct
tgtggctttgcgctggacttgtgccagcatcaggacagggtacagaatctaagaaaagac
ttcacagagctacagaagacagttaaagagagagagaaagatgcatcatcttgccaggaa
cagttggatgaattccggaagctggtcaggaccttccagaaatggttgaaagaaactgaa
gggagtattccacctacggaaacttctatgagtgctaaagagttagaaaagcagattgaa
cacctgaagagtctactagatgactgggcaagtaagggaactctggtggaagaaatcaat
tgcaaaggtacttctttagaaaatctcatcatggaaatcacagcacctgattcccaaggc
aagacaggttccatactgccctctgtaggaagctctgtaggcagtgtaaacggataccac
acctgcaaagatctgacggagatccagtgtgacatgtcagatgtaaacttgaagtatgag
aaactagggggagtacttcatgaacgccaggaaagccttcaggctatcctcaacagaatg
gaggaggttcacaaggaggcaaactctgtgctgcagtggctggaatcaaaagaggaagtc
ctgaaatccatggatgccatgtcatctccaaccaagacagaaacagtgaaagcccaagct
gaatctaacaaggccttcctggctgagttggaacagaattctccaaaaattcaaaaagta
aaggaagccctggctggattactggtgacatatcccaactcacaggaagcagaaaattgg
aagaaaattcaggaagaactcaattcccgatgggaaagggccactgaggttactgtggct
cggcaaaggcagctagaggaatctgcaagtcatctggcctgcttccaggctgcagaatcc
cagctccggccgtggctgatggagaaagaactgatgatgggagtgctggggcccctgtct
attgaccccaacatgttgaatgcacaaaagcaacaggtccagtttatgctaaaggaattt
gaagcacgcaggcaacagcatgagcaactgaatgaggcagctcagggcatcctaacaggc
cctggagatgtctctctgtccaccagccaagtacagaaagaactccagagcatcaatcag
aaatgggttgagctgactgacaaactcaactcccgttccagccaaattgaccaagctatt
gttaagagcacccagtaccaggaactgctccaggacttatcagagaaggtgagggcagtt
ggacaacggctgagtgtccagtcagctatcagcacccaaccagaggctgtaaagcagcaa
ttggaagagaccagtgaaattcgatctgacttggagcagttagaccacgaggttaaggag
gctcagacactgtgcgatgaactctcagtgctcattggtgagcagtacctcaaggatgaa
ctgaagaagcgtttggagacagttgccctgcctctccaaggtttagaagaccttgcagcc
gatcgcattaacagactccaggcagctcttgccagcacccagcagttccagcaaatgttt
gatgagttgaggacctggttggatgataaacaaagccagcaagcaaaaaactgcccaatt
tctgcaaaattggagcggctacagtctcagctacaggagaatgaagagtttcagaaaagt
cttaatcaacacagtggctcctatgaggtgattgtggctgaaggggaatctctacttctt
tctgtacctcctggagaagagaaaaggactctacaaaaccagttggttgagctcaaaaac
cattgggaagagcttagtaaaaaaactgcagacagacaatccaggctcaaggattgtatg
cagaaagctcagaaatatcagtggcatgtggaagaccttgtgccatggatagaagattgt
aaagctaagatgtctgagttgcgagtcactctggatccagtgcagctagagtccagtctc
ctaagatcaaaggctatgctgaatgaggtggagaagcgccgctccctgctggaaatattg
aatagtgctgctgacattctgatcaattcttcagaagcagatgaggatggaatccgggat
gagaaggctgggatcaaccagaacatggatgctgttacagaagagctgcaggccaaaaca
gggtcactcgaagaaatgactcagaggctcagggagttccaggaaagctttaagaatatt
gaaaagaaggttgaaggagccaaacaccaacttgagatctttgatgctctgggttctcaa
gcctgtagcaacaagaacctggagaagctaagagctcaacaggaagtgctgcaggcccta
gagcctcaggtagactatctgaggaactttactcagggtctggtagaagatgccccagat
ggatctgatgcttctcaacttctccaccaagctgaggtcgcccagcaagagttcctcgaa
gttaagcaaagagtgaacagtggttgtgtgatgatggaaaacaagctggaggggattggc
cagtttcactgccgggtccgagagatgttctctcaattggcagacctggatgatgagcta
gatggcatgggtgctattggcagagacactgatagcctccagtcccaaatcgaggatgtc
cggctattccttaacaaaattcacgtcctcaaattagacatagaggcctctgaagcagag
tgtcgacatatgctagaagaagaggggactctggatttgttaggtctcaaaagggagcta
gaagccctgaacaaacagtgtggcaaactgacagagagggggaaagctcgtcaggaacag
ctggaactgacactaggccgtgtagaggacttctacaggaaattgaaaggactcaatgac
gcgaccacagcagcagaggaggcagaggccctccagtgggtagtggggaccgaagtggaa
atcatcaaccaacaattagcagattttaaaatgtttcagaaagaacaagtggatcctctt
cagatgaaattgcagcaggtgaatggacttggccagggattaattcagagtgcaggaaaa
gactgtgatgtacagggtttagaacatgacatggaagagatcaatgctcgatggaataca
ttgaataaaaaggtcgcacaaagaattgcacagctacaggaagctttgttgcattgtggg
aagtttcaagatgccttggagccattgctcagctggttggcagataccgaggagctcata
gccaatcagaaacctccatctgctgagtataaagtggtgaaagcacagatccaagaacag
aagttgctccagcggctcctagatgatcgaaaggccacagtagacatgcttcaagcagaa
ggaggcagaatagcccagtcagcagagctggctgatagagagaaaatcactggacagctg
gagagtcttgaaagtagatggactgaactactcagtaaggcagcagccaggcaaaaacag
ctggaagacatcctggttctggccaaacagttccatgagacagctgagcctatttctgac
ttcttatctgtcacagagaaaaagcttgctaactcagaacctgttggcactcagactgcc
aaaatacagcagcagatcattcggcacaaggctctggaagaagacatagaaaaccatgca
acagatgtgcaccaggcagtcaaaattgggcagtccctctcctccctgacatctcctgca
gaacagggtgtgctgtcagaaaagatagactcattgcaggcccgatacagtgaaattcaa
gaccgctgttgtcggaaggcagccctacttgaccaagctctgtctaatgctaggctgttt
ggggaggatgaggtggaggtgctcaactggctggctgaggttgaggacaagctcagttca
gtgttcgtaaaggatttcaaacaggatgtcctgcacaggcagcatgctgaccacctggct
ttaaatgaagaaattgttaatagaaagaagaatgtagatcaagctattaaaaatggtcag
gctcttctaaaacaaaccacaggtgaggaggtgttacttatccaggaaaaactagatggt
ataaagactcgttacgcagacatcacagttactagctccaaggccctcagaactttagag
caagcccggcagctggccaccaagttccagtctacttatgaggaactgaccgggtggctg
agggaggtggaggaggagctggcaaccagtggaggacagtctcccacaggggaacagata
ccccagtttcagcagagacagaaggaattaaagaaggaggtcatggagcacaggctggtg
ttggacacagtgaatgaggtgagccgtgctctcttagagctggtgccctggagagccaga
gaagggctggataaacttgtgtccgatgctaacgagcagtacaaactagtcagtgacact
attggacaaagggtggatgaaattgatgctgctattcagagatcacaacagtatgagcaa
gctgccgatgcagaactagcttgggttgctgaaacaaaacggaaactgatggctctgggt
ccaattcgcctggaacaggaccagaccacagctcagcttcaggtacagaaggctttctcc
attgacattattcgacacaaagattcaatggatgaactcttcagtcaccgtagtgaaatc
tttggcacatgtggggaggagcaaaaaactgtattacaggaaaagacagagtctctaata
cagcaatatgaagccattagcctactcaattcagagcgttatgcccgcctagagcgggcc
caggtcttagtaaaccagttttgggaaacttatgaagagctcagcccctggattgaggaa
actcgggcactaatagcacagttaccctctccagccattgatcatgagcagctcaggcag
caacaagaggaaatgaggcaattaagggaatctattgctgaacacaaacctcatattgac
aaactactaaagataggcccacaactaaaggaattaaaccctgaggaaggggaaatggtg
gaagaaaaataccagaaagcagaaaacatgtatgcccaaataaaggaggaggtgcgccag
cgagccctggctctggatgaagccgtgtcccagtccacacagattacagagtttcatgat
aaaattgagcctatgttggagacactggagaatctttcctctcgcctgcgtatgccacca
ctgatccctgctgaagtagacaagatcagagagtgcatcagtgacaataagagtgccacc
gtggagctagaaaaactgcagccatcctttgaggccttgaagcgccgtggagaggagctt
attggacgatctcagggagcagacaaggatctggctgcaaaagaaatccaggataaattg
gatcaaatggtattcttctgggaggacatcaaagctcgggctgaagaacgagaaatcaaa
tttcttgatgtccttgaattagcagagaagttctggtatgacatggcagctctcctgacc
accatcaaagacacccaggatattgtccatgacttggaaagcccaggcattgatccttcc
atcatcaaacaacaggttgaagctgctgagactattaaggaagagacagatggtctgcat
gaagagctggagtttattcggatccttggagcagatttgatttttgcctgtggagaaact
gagaagcctgaagtgaggaagagcattgatgagatgaataatgcttgggagaacttaaac
aaaacatggaaagagaggctagaaaaacttgaggatgctatgcaagctgctgtgcagtat
caggacactcttcaggctatgtttgactggctagataacactgtgattaaactctgcacc
atgccccctgttggcactgacctcaatactgttaaagatcagttaaatgaaatgaaggag
ttcaaagtagaagtttaccaacagcaaattgagatggagaagcttaatcaccagggtgaa
ctgatgttaaagaaagctactgatgagacggacagagacattatacgagaaccactgaca
gaactcaaacacctctgggagaacctgggtgagaaaattgcccaccgacagcacaaacta
gaaggggctctgttggcccttggtcagttccagcatgccttagaggaactaatgagttgg
ctgactcataccgaagagttgttagatgctcagagaccaataagtggagacccaaaagtc
attgaagttgagctcgcaaagcaccatgtcctaaaaaatgatgttttggctcatcaagcc
acagtggaaacagtcaacaaagctggcaatgagcttcttgaatccagtgctggagatgat
gccagcagcttaaggagccgtttggaagccatgaaccaatgctgggagtcagtgttacag
aaaacagaggagagggagcagcagcttcagtcaactctgcagcaggcccagggcttccac
agtgaaattgaagatttcctcttggaacttactagaatggagagccagctttctgcatct
aagcccacaggaggacttcctgaaactgctagggaacagcttgatacacatatggaactc
tattcccagctgaaagccaaggaagagacttataatcaactacttgacaagggcagactc
atgcttctaagccgtgacgactctgggtctggctccaagacagaacagagtgtagcactt
ttggagcagaagtggcatgtggtcagcagtaagatggaagaaagaaagtcaaagctggaa
gaggccctcaacttggcaacagaattccagaattccctacaagaatttatcaactggctc
actctagcagagcagagtttaaacatcgcttctccaccaagcctgattctaaatactgtc
ctttcccagatagaagagcacaaggtttttgctaatgaagtaaatgctcatcgagaccag
atcattgagctggatcaaactgggaatcaattaaagttccttagccaaaagcaggatgtt
gttctgatcaagaatttgttggtgagcgtgcagtctcgatgggagaaggttgtccagcga
tctattgaaagagggcgatcactagatgatgccaggaagcgggcaaaacaattccatgaa
gcttggaaaaaactgattgactggctagaagatgcagagagtcacctggactcagaacta
gagatatccaatgacccagacaaaattaaacttcagctttctaagcataaggagtttcag
aagactcttggtggcaagcagcctgtgtatgataccacaattagaactggcagagcactg
aaagaaaagactttgcttcccgaagatagtcagaaacttgacaatttcctaggagaagtc
agagacaaatgggatactgtttgtggcaagtctgtggagcggcagcacaagttggaggaa
gccctgctcttttcgggtcagttcatggatgctttgcaggcattggttgactggttatac
aaggtggagccacagctggctgaggaccagcccgtgcacggggaccttgacctcgtcatg
aacctcatggatgcacacaaggttttccagaaggaactgggaaagcgaacaggaaccgtt
caggtcctgaagcggtcaggccgagagctgattgagaatagtcgagatgacaccacttgg
gtaaaaggacagctccaggaactgagcactcgctgggacactgtctgtaaactctctgtt
tccaaacaaagccggcttgagcaggccttaaaacaagcggaagtgtttcgagacacagtc
cacatgctgttggagtggctttctgaagcagagcaaacgcttcgctttcggggagcactt
cctgatgacacagaggccctgcagtctctcattgacacccataaggaattcatgaagaaa
gtagaagaaaagcgagtggacgttaactcagcagtagccatgggagaagtcatcctggct
gtctgccaccccgattgcatcacaaccatcaaacactggatcaccatcatccgagctcgc
ttcgaggaggtcctgacatgggctaagcagcaccagcagcgtcttgaaacggccttgtca
gaactggtggctaatgctgagctcctggaagaacttctggcatggatccagtgggctgag
accaccctcattcagcgggatcaggagccaatcccgcagaacattgaccgagttaaagcc
cttatcgctgagcatcagacatttatggaggagatgactcgcaaacagcctgacgtggac
cgggtcaccaagacatacaaaaggaaaaacatagagcctactcacgcgcctttcatagag
aaatcccgcagcggaggcaggaaatccctaagtcagccaacccctcctcccatgccaatc
ctttcacagtctgaagcaaaaaacccacggatcaaccagctttctgcccgctggcagcag
gtgtggctgttagcactggagcggcaaaggaaactgaatgatgccttggatcggctggag
gagttgaaagaatttgccaactttgactttgatgtctggaggaaaaagtatatgcgttgg
atgaatcacaaaaagtctcgagtgatggatttcttccggcgcattgataaggaccaggat
gggaagataacacgtcaggagtttatcgatggcattttagcatccaagttccccaccacc
aagttagagatgactgctgtggctgacattttcgaccgagatggggatggttacattgat
tattatgaatttgtggctgctcttcatcccaacaaggatgcgtatcgaccaacaaccgat
gcagataaaatcgaagatgaggttacaagacaagtggctcagtgcaaatgtgcaaaaagg
tttcaggtggagcagatcggagagaataaataccggtttggggattctcagcagttgcgg
ctggtccgtattctgcgcagcaccgtgatggttcgcgttggtggaggatggatggccttg
gatgaatttttagtgaaaaatgatccctgccgagcacgaggtagaactaacattgaactt
agagagaaattcatcctaccagagggagcatcccagggaatgacccccttccgctcacgg
ggtcgaaggtccaaaccatcttcccgggcagcttcccctactcgttccagctccagtgct
agtcagagtaaccacagctgtacatccatgccatcttctccagccaccccagccagtgga
accaaggttatcccatcatcaggtagcaagttgaaacgaccaacaccaacttttcattct
agtcggacatcccttgctggtgataccagcaatagttcttccccggcctccacaggtgcc
aaaactaatcgggcagaccctaaaaagtctgccagtcgccctgggagtcgggctgggagt
cgagccgggagtcgagccagcagccggcgaggaagtgacgcttctgactttgacctctta
gagacgcagtctgcttgttccgacacttcagaaagcagcgctgcagggggccaaggcaac
tccaggagagggctaaacaaaccttccaaaatcccaaccatgtctaagaagaccaccact
gcctcccccaggactccaggtcccaagcgataa

DBGET integrated database retrieval system