KEGG   Homo sapiens (human): 23506Help
Entry
23506             CDS       T01001                                 

Gene name
BICRAL, GLTSCR1L, KIAA0240
Definition
(RefSeq) BRD4 interacting chromatin remodeling complex associated protein like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GLTSCR1
Motif
Other DBs
NCBI-GeneID: 23506
NCBI-ProteinID: NP_001305748
OMIM: 618502
HGNC: 21111
Ensembl: ENSG00000112624
Vega: OTTHUMG00000014706
Pharos: Q6AI39(Tdark)
UniProt: Q6AI39
Position
6p21.1
AA seq 1079 aa AA seqDB search
MDDDDDSCLLDLIGDPQALNYFLHGPSNKSSNDDLTNAGYSAANSNSIFANSSNADPKSS
LKGVSNQLGEGPSDGLPLSSSLQFLEDELESSPLPDLTEDQPFDILQKSLQEANITEQTL
AEEAYLDASIGSSQQFAQAQLHPSSSASFTQASNVSNYSGQTLQPIGVTHVPVGASFASN
TVGVQHGFMQHVGISVPSQHLSNSSQISGSGQIQLIGSFGNHPSMMTINNLDGSQIILKG
SGQQAPSNVSGGLLVHRQTPNGNSLFGNSSSSPVAQPVTVPFNSTNFQTSLPVHNIIIQR
GLAPNSNKVPINIQPKPIQMGQQNTYNVNNLGIQQHHVQQGISFASASSPQGSVVGPHMS
VNIVNQQNTRKPVTSQAVSSTGGSIVIHSPMGQPHAPQSQFLIPTSLSVSSNSVHHVQTI
NGQLLQTQPSQLISGQVASEHVMLNRNSSNMLRTNQPYTGPMLNNQNTAVHLVSGQTFAA
SGSPVIANHASPQLVGGQMPLQQASPTVLHLSPGQSSVSQGRPGFATMPSVTSMSGPSRF
PAVSSASTAHPSLGSAVQSGSSGSNFTGDQLTQPNRTPVPVSVSHRLPVSSSKSTSTFSN
TPGTGTQQQFFCQAQKKCLNQTSPISAPKTTDGLRQAQIPGLLSTTLPGQDSGSKVISAS
LGTAQPQQEKVVGSSPGHPAVQVESHSGGQKRPAAKQLTKGAFILQQLQRDQAHTVTPDK
SHFRSLSDAVQRLLSYHVCQGSMPTEEDLRKVDNEFETVATQLLKRTQAMLNKYRCLLLE
DAMRINPSAEMVMIDRMFNQEERASLSRDKRLALVDPEGFQADFCCSFKLDKAAHETQFG
RSDQHGSKASSSLQPPAKAQGRDRAKTGVTEPMNHDQFHLVPNHIVVSAEGNISKKTECL
GRALKFDKVGLVQYQSTSEEKASRREPLKASQCSPGPEGHRKTSSRSDHGTESKLSSILA
DSHLEMTCNNSFQDKSLRNSPKNEVLHTDIMKGSGEPQPDLQLTKSLETTFKNILELKKA
GRQPQSDPTVSGSVELDFPNFSPMASQENCLEKFIPDHSEGVVETDSILEAAVNSILEC
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatgatgactcgtgtctccttgatcttattggagacccacaagcattgaac
tattttctacatggacctagtaataaatctagcaatgatgacttgactaatgcaggatat
tctgcagccaattcaaattcaattttcgccaactctagtaatgctgatcctaagtcatcc
ctcaaaggtgtaagcaaccagcttggagaagggcccagtgatggactgccactttcaagt
agcctccagtttcttgaagatgaactcgagtcttctcctcttcctgatctcactgaggac
caacctttcgacattcttcagaaatccttgcaagaggccaatatcactgaacagacattg
gcagaagaggcatatttggatgccagtataggttcaagccaacagtttgcacaagctcag
cttcatccttcttcatcagcatcctttactcaggcttctaatgtttctaattactcaggt
cagacgctgcagcctataggggtgacgcatgtgcctgttggagcatcgtttgcaagcaat
acagtgggtgtacaacatggctttatgcaacatgtggggatcagtgttcccagccagcat
ttgtctaatagcagtcagattagtggttctggtcaaatacagttaattgggtcatttggt
aatcatccttccatgatgactattaataacctagatggatctcaaatcatattaaagggc
agcgggcagcaagccccatcaaatgtgagtggagggctcctggttcatagacagactcct
aatggcaactccttgtttgggaactctagttccagtccagtagcacagcctgttaccgtt
ccatttaacagcacaaattttcaaacatctttacctgtgcataacatcatcatacaaagg
ggtcttgcaccaaattcaaataaagtcccaattaatatacagccaaagcctatccagatg
ggtcagcaaaatacatacaatgtgaacaatttgggaattcagcagcaccacgtacaacaa
gggatctcttttgcttctgcaagctcaccccagggctcagtagttggtccacacatgtct
gtgaacattgtaaaccaacagaacacaagaaagccagtcacctcacaggcagtgagcagc
actgggggcagtattgttattcattcccccatgggccaacctcacgcaccccaaagtcag
ttccttatacctacaagcctttctgtcagttccaactcggtacaccacgtccagactata
aatgggcaacttcttcaaactcaaccctctcagctcatttctggccaagtggcctcagag
catgtcatgttgaacagaaactcttccaacatgctcaggaccaaccaaccatatactgga
ccgatgcttaacaaccagaatactgctgtccacttagtgtctgggcagacatttgctgcc
tctggaagtccagtgatagccaatcatgcctctcctcagcttgtgggtggacagatgccc
ttgcagcaggcatccccaactgtattacacctgtcacctgggcagagcagcgtttcccaa
ggaagacctggcttcgccaccatgccatcggtgacaagcatgtcaggacctagtcggttc
cctgctgtcagctcagccagcactgcccatcctagtcttgggtctgcagttcagtctggt
tcatcaggatcaaactttacaggagatcagctgacccagccaaacaggactccagtacca
gtcagtgtgtctcatcgtcttccagtttcttcttccaagtctaccagcaccttcagtaac
acacctggaacaggaacccagcaacaattcttctgccaggctcagaaaaaatgtctgaat
cagacttcccccatttctgctcccaagaccacagacggcctgaggcaagcacagatccct
gggctcttgagcaccacactgccagggcaggattctggaagcaaagttatatccgcatcc
ttaggaaccgcacaaccacagcaggaaaaagtagttggatcatctcctggccatccagct
gtgcaggtggagagtcattcgggaggacaaaaaaggcctgctgcgaaacagctaacgaaa
ggagctttcattctccagcagttgcagagggaccaagcccacactgtgacaccagacaaa
agtcacttccgatcactaagtgatgcggtacagagactgctctcctaccacgtgtgccag
ggctccatgcccactgaagaagacttgagaaaagtggacaatgaatttgagacagttgcc
actcagctcctaaaaaggacccaagctatgcttaacaaatacagatgcctgctcctagaa
gatgccatgcgaatcaatccctctgctgagatggtgatgatcgataggatgttcaaccag
gaggaaagagcttccctgtcccgagacaagcgtttggcacttgtagaccctgagggtttt
caggctgatttctgttgttccttcaaacttgataaagctgctcatgagacacagtttggc
cggagtgaccagcatggcagtaaagcaagcagctctctgcaaccgccagccaaggcccaa
ggcagagaccgagccaaaaccggtgtgacggaacccatgaatcatgaccagtttcatcta
gtgcctaatcacatcgtggtctctgcagaaggaaacatttctaaaaaaacagaatgcctt
ggcagagcactgaaatttgacaaagtgggcttagtgcagtaccagagcacgtctgaagag
aaggccagccggagagagcctctgaaggccagtcagtgctctcccggccctgaggggcac
cggaaaacctcatccagatcggatcatggtactgagagcaaactgtcaagcatcctagca
gattcgcacttggagatgacgtgtaacaattccttccaggacaaaagtctgaggaattct
ccaaagaatgaagttttacacacagacatcatgaaagggtcaggcgaaccccagccagat
ctccagctgacaaagagcttggaaaccacatttaagaacatcttggaactcaaaaaggcg
ggacggcagccccagagtgaccccacggttagcggctctgttgagttagatttccccaac
ttttctcctatggcttcacaggaaaactgcctggaaaagttcatcccggaccacagtgaa
ggtgttgtagaaactgactccattttagaagcagctgtaaatagtatcctagagtgttaa

DBGET integrated database retrieval system