KEGG   Homo sapiens (human): 23514Help
Entry
23514             CDS       T01001                                 

Gene name
SPIDR, KIAA0146
Definition
(RefSeq) scaffold protein involved in DNA repair
  KO
K22806  DNA repair-scaffolding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    23514 (SPIDR)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     23514 (SPIDR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4503 DUF4502
Motif
Other DBs
NCBI-GeneID: 23514
NCBI-ProteinID: NP_001073863
OMIM: 615384
HGNC: 28971
Ensembl: ENSG00000164808
Vega: OTTHUMG00000164176
Pharos: Q14159(Tbio)
UniProt: Q14159
Position
8q11.21
AA seq 915 aa AA seqDB search
MPRGSRARGSKRKRSWNTECPSFPGERPLQVRRAGLRTAGAAASLSEAWLRCGEGFQNTS
GNPSLTAEEKTITEKHLELCPRPKQETTTSKSTSGLTDITWSSSGSDLSDEDKTLSQLQR
DELQFIDWEIDSDRAEASDCDEFEDDEGAVEISDCASCASNQSLTSDEKLSELPKPSSIE
ILEYSSDSEKEDDLENVLLIDSESPHKYHVQFASDARQIMERLIDPRTKSTETILHTPQK
PTAKFPRTPENSAKKKLLRGGLAERLNGLQNRERSAISLWRHQCISYQKTLSGRKSGVLT
VKILELHEECAMQVAMCEQLLGSPATSSSQSVAPRPGAGLKVLFTKETAGYLRGRPQDTV
RIFPPWQKLIIPSGSCPVILNTYFCEKVVAKEDSEKTCEVYCPDIPLPRRSISLAQMFVI
KGLTNNSPEIQVVCSGVATTGTAWTHGHKEAKQRIPTSTPLRDSLLDVVESQGAASWPGA
GVRVVVQRVYSLPSRDSTRGQQGASSGHTDPAGTRACLLVQDACGMFGEVHLEFTMSKAR
QLEGKSCSLVGMKVLQKVTRGRTAGIFSLIDTLWPPAIPLKTPGRDQPCEEIKTHLPPPA
LCYILTAHPNLGQIDIIDEDPIYKLYQPPVTRCLRDILQMNDLGTRCSFYATVIYQKPQL
KSLLLLEQREIWLLVTDVTLQTKEERDPRLPKTLLVYVAPLCVLGSEVLEALAGAAPHSL
FFKDALRDQGRIVCAERTVLLLQKPLLSVVSGASSCELPGPVMLDSLDSATPVNSICSVQ
GTVVGVDESTAFSWPVCDMCGNGRLEQRPEDRGAFSCGDCSRVVTSPVLKRHLQVFLDCR
SRPQCRVKVKLLQRSISSLLRFAAGEDGSYEVKSVLGKEVGLLNCFVQSVTAHPTSCIGL
EEIELLSAGGASAEH
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcggcagccgcgctcggggctctaagagaaaaaggagttggaatacagaatgc
ccatcctttccaggagaaagaccactgcaggtcagaagagcaggtctcaggacagcaggg
gcagctgcctctctctctgaagcatggctcaggtgtggagaagggtttcagaacacttct
gggaatccgtcattaacagctgaagagaagacgattacagaaaagcaccttgaattatgc
cctagacccaagcaagaaaccaccacatctaaaagcaccagtgggcttacagacataaca
tggagctccagtggaagtgatttgtcggatgaagataagacactttctcagttacagaga
gatgaattacagtttatcgactgggagattgacagtgacagggcagaggctagtgactgt
gatgaatttgaagatgacgagggtgctgtggaaatctcagactgtgcttcttgtgcaagt
aatcagtctttgacaagtgatgagaagctgtcggagcttcccaagccaagttctatagaa
attttagagtattcatcagatagtgaaaaagaagatgatttggaaaatgtcctactcatt
gattcagaatcccctcacaaataccacgtgcagtttgcatcggatgcaagacagattatg
gagagactgatagatccaaggacaaaatcaacagagaccattttgcatacacctcagaaa
cccacagctaagtttcccaggactccagaaaattcagcaaagaagaagcttttaagaggt
ggactagcagaaagactaaatggactgcagaatcgagagagatctgctatttctttgtgg
agacatcaatgtatttcttaccaaaagacactttcaggtagaaaatctggtgtattaact
gtgaaaattttagagctgcatgaggaatgtgccatgcaagttgccatgtgtgagcagtta
ttggggtcaccagccaccagctcctcccaaagtgtggctcccaggcctggagctggcctg
aaagttctcttcaccaaggagactgcaggctacctcaggggccgtccccaggacactgtc
cggatcttccctccctggcaaaaactgattattccaagtggaagttgccctgttattctg
aatacttacttttgtgagaaagttgttgccaaagaagattcagaaaaaacttgtgaagtg
tactgtccggacataccccttccaagaagaagcatctctttggcccagatgtttgtaatt
aagggtctaacaaataattcacctgaaatccaggttgtgtgtagtggtgtagccactaca
gggacagcctggacccatgggcacaaagaagcaaaacagcgcatcccaaccagcactccc
ctgagggattctctcctggatgtggtggaaagccagggagctgcctcgtggccaggagct
ggagtccgagtggtggtgcaaagagtgtattctcttcccagcagagacagcaccaggggt
cagcagggggccagctcaggacacacagacccagctggaactcgagcctgccttctggta
caagatgcctgtggaatgttcggtgaagtgcacttggagttcaccatgtcgaaggcaaga
cagttggaagggaagtcttgcagcctggtgggaatgaaggttctacagaaagtcaccaga
ggaaggacagcggggattttcagtttgattgacaccctgtggcccccagcgatacctctg
aaaacacctggccgcgaccagccctgtgaagagataaaaactcatctgcctcctccagcc
ttgtgttacatcctcacagctcatccaaatctgggacaaattgatataattgacgaagac
cccatttataagctttaccagcctccagttacccgctgcttaagagacattctccagatg
aatgatcttggtacccgttgcagtttctatgccacggtgatttaccaaaaaccacagctg
aagagtctgctgcttctggagcaaagggagatctggctgctagtgaccgatgtcactctg
caaacgaaggaggagagagaccccaggctccccaaaaccctgctggtctatgtggccccc
ttgtgtgtgctgggctctgaagtcctggaggcactcgctggggctgcccctcacagcctc
ttcttcaaggacgctctccgtgaccagggtcggattgtttgtgctgaacgaactgtcctc
ttgcttcagaagccccttttgagtgtggtctctggtgcaagttcctgtgagctgcctggc
ccggtgatgctcgacagcctggactctgcaacacctgtcaactccatctgcagtgttcaa
ggcactgtggttggcgtggacgagagcactgctttctcatggcctgtgtgtgacatgtgt
ggcaacgggagattggaacagaggccggaagacagaggcgccttttcctgtggggactgc
tcccgggtggtcacatctcctgttctcaagaggcacctgcaggtcttcctggactgccgc
tcaagaccgcagtgcagagtgaaggtcaagctgttgcagcgcagcatttcctccctgctg
aggtttgccgccggtgaagatgggagctacgaagtgaagagtgtcctcggaaaggaagtg
gggttgttaaattgttttgtccagtccgtaaccgcccacccgaccagctgcattggattg
gaggaaatcgagcttctgagtgcaggaggggcctctgcagaacactag

DBGET integrated database retrieval system