KEGG   Homo sapiens (human): 23517
Entry
23517             CDS       T01001                                 

Symbol
MTREX, Dob1, KIAA0052, Mtr4, SKIV2L2, fSAP118
Name
(RefSeq) Mtr4 exosome RNA helicase
  KO
K12598  ATP-dependent RNA helicase DOB1 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    23517 (MTREX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23517 (MTREX)
   03041 Spliceosome [BR:hsa03041]
    23517 (MTREX)
   03009 Ribosome biogenesis [BR:hsa03009]
    23517 (MTREX)
   03016 Transfer RNA biogenesis [BR:hsa03016]
    23517 (MTREX)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     23517 (MTREX)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     23517 (MTREX)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    23517 (MTREX)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    23517 (MTREX)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    23517 (MTREX)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    23517 (MTREX)
SSDB
Motif
Pfam: rRNA_proc-arch DSHCT DEAD Helicase_C AAA_19 AAA_22
Other DBs
NCBI-GeneID: 23517
NCBI-ProteinID: NP_056175
OMIM: 618122
HGNC: 18734
Ensembl: ENSG00000039123
Vega: OTTHUMG00000097019
Pharos: P42285(Tbio)
UniProt: P42285 Q3MHC9
Structure
PDB: 

Position
5q11.2
AA seq 1042 aa
MADAFGDELFSVFEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNG
KNKRDVDFEGTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEE
DYLPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALR
EKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGS
EVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLH
KQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGD
QKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMV
EEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALF
ATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVD
EKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPG
VVEKVKNSEEQYNKIVIPNEESVVIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLV
KVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESLKNSATEAAKPAKP
DEKGEMQVVPVLVHLLSAISSVRLYIPKDLRPVDNRQSVLKSIQEVQKRFPDGIPLLDPI
DDMGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCEKKAQIAIDIKSAKRELK
KARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDL
SAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEIDEETYLS
SFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELE
NKFAEGITKIKRDIVFAASLYL
NT seq 3129 nt   +upstreamnt  +downstreamnt
atggcggacgcattcggagatgagctgttcagcgtgttcgagggcgactcgaccactgcg
gcgggaaccaaaaaagacaaggaaaaggacaaggggaaatggaaggggcctccagggtct
gcagacaaggcagggaaacgttttgatggtaaattacaatcagaatcaactaataatgga
aaaaataagagagatgtagatttcgaaggtacagatgaacccatttttggaaagaagccc
aggatagaagagtcaataactgaagacttaagtttggcagacctgatgcccagagtcaag
gtacaatcagttgaaactgttgaagggtgtacacatgaggttgcacttcctgcagaagag
gattatttaccacttaaaccacgagttggaaaagctgctaaggaatacccgttcattctt
gatgcttttcaaagagaggccattcagtgtgttgacaataatcagtctgttctagtatct
gcacatacctcagcgggaaaaacagtatgcgccgagtatgccattgcattggccttaagg
gaaaagcagcgtgtaatatttaccagcccaattaaggctctgagtaaccaaaaataccgt
gaaatgtatgaagaatttcaagatgttggtttgatgactggtgatgttactattaatcct
acggcatcttgtcttgttatgaccacagagattttgagaagtatgctttacagaggttcc
gaagttatgagagaagttgcttgggttatatttgatgaaattcattatatgagagattca
gaacgtggtgtagtatgggaagaaactattattttgcttcctgataacgtccactatgtc
tttctttcggctactattccaaatgcccgacagtttgctgaatggatttgccatttacat
aaacagccttgtcatgttatttacacagattatcggcccactccattgcaacactacatt
tttccagcagggggagatggcctgcatcttgtggttgatgaaaatggtgacttcagagaa
gataattttaatactgcaatgcaagtgcttcgagatgcaggtgatttggccaaaggagac
cagaaagggcggaaaggaggaacaaaaggaccatcaaatgttttcaaaattgtgaagatg
attatggaaagaaatttccaacctgtgattattttcagttttagtaagaaagattgtgaa
gcctatgcacttcaaatgaccaaattagatttcaacacagatgaagaaaagaagatggtt
gaagaagtattcagtaatgcaattgattgcttatccgatgaagataaaaaactccctcag
gtagaacatgtacttcctcttttgaagaggggaattggtattcaccatggtggtttactt
cctattttgaaagaaactatagaaattctcttttctgaaggattgataaaggccttattt
gccacggagacctttgctatgggaattaacatgccagctagaactgttttatttacaaat
gcccgcaaatttgatgggaaggatttccgatggatttcttctggtgaatacattcagatg
tctggtcgtgctggaaggagaggaatggatgatagaggaattgtaattcttatggtagat
gaaaagatgagcccaacaattggaaaacaattacttaagggctccgctgatcctctaaat
agtgctttccatttgacctacaacatggttttgaacttactacgtgtagaagaaattaat
cctgagtacatgttggaaaaatccttctaccagtttcagcattatagagcaattccagga
gtagtagagaaggtaaagaattcagaagaacagtataataaaatagtaattcccaatgaa
gaaagtgtggttatctattataagattagacagcagcttgccaaattgggtaaagaaatt
gaagaatatattcacaaaccaaaatactgcttaccttttctacaaccaggtcgtttggta
aaggtaaagaatgaaggagatgactttggctggggagtagtggtgaatttctcaaaaaag
tcaaatgttaagcctaactctggtgaactggatcctttgtatgtagtagaagtacttctg
cgctgtagcaaagagagcttgaaaaattcagctacagaagctgcaaaaccagctaaacct
gatgagaaaggagagatgcaggttgtcccagttttggtgcatctcctgtctgctatcagc
agtgttaggctttacattcctaaagaccttcggccggtggacaatagacagagtgtttta
aaatcaatacaggaagttcagaaacgttttcctgacggcatccccttattagaccctatt
gatgatatgggcattcaagatcaagggctgaaaaaagtcattcagaaagtagaagctttt
gagcatcgaatgtattctcatccacttcacaatgatccaaatttggaaactgtgtatacg
ctttgtgaaaaaaaagcacagattgcaatagatattaaatctgcaaagcgagaactgaag
aaagcaagaacagtcctacaaatggatgaactcaaatgtcgcaaacgtgttttaagaagg
ttgggatttgctacttcttctgatgtaatagagatgaaaggacgagtggcttgtgagata
agcagtgctgatgagctccttctaactgagatgatgtttaatggccttttcaatgacctt
tctgcagaacaggcaacagcattattaagctgctttgtgtttcaagagaattctagtgag
atgcccaaattaacagaacaattagcaggaccacttcgtcaaatgcaggaatgtgctaaa
agaattgcaaaagtttcagcagaagccaaattggaaattgatgaggaaacttatctaagc
tcatttaaacctcacttaatggatgtagtatatacctgggcaactggagctacatttgcc
catatctgcaaaatgacagatgtctttgaaggcagcataattcgttgtatgaggcgcctg
gaagaattgcttcgacaaatgtgtcaagcagcaaaagccattggaaacactgagctggaa
aataaatttgcagaaggaatcaccaaaatcaagagagatattgtgtttgctgccagcctc
tacttgtag

DBGET integrated database retrieval system