KEGG   Homo sapiens (human): 2352
Entry
2352              CDS       T01001                                 

Gene name
FOLR3, FR-G, FR-gamma, FRgamma, gamma-hFR
Definition
(RefSeq) folate receptor gamma
  KO
K13649  folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04144  Endocytosis
Drug target
Vintafolide: D10434
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2352 (FOLR3)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    2352 (FOLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2352 (FOLR3)
   04147 Exosome [BR:hsa04147]
    2352 (FOLR3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2352 (FOLR3)
Transporters [BR:hsa02000]
 Other transporters
  Others
   2352 (FOLR3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2352 (FOLR3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2352 (FOLR3)
SSDB
Motif
Pfam: Folate_rec
Other DBs
NCBI-GeneID: 2352
NCBI-ProteinID: NP_000795
OMIM: 602469
HGNC: 3795
Ensembl: ENSG00000110203
Vega: OTTHUMG00000167870
Pharos: P41439(Tdark)
UniProt: P41439
Position
11q13.4
AA seq 245 aa
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPW
KKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQV
NQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFES
YFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSR
GIIDS
NT seq 738 nt   +upstreamnt  +downstreamnt
atggacatggcctggcagatgatgcagctgctgcttctggctttggtgactgctgcgggg
agtgcccagcccaggagtgcgcgggccaggacggacctgctcaatgtctgcatgaacgcc
aagcaccacaagacacagcccagccccgaggacgagctgtatggccagtgcagtccctgg
aagaagaatgcctgctgcacggccagcaccagccaggagctgcacaaggacacctcccgc
ctgtacaactttaactgggatcactgtggtaagatggaacccacctgcaagcgccacttt
atccaggacagctgtctctatgagtgctcacccaacctggggccctggatccggcaggtc
aaccagagctggcgcaaagagcgcattctgaacgtgcccctgtgcaaagaggactgtgag
cgctggtgggaggactgtcgcacctcctacacctgcaaaagcaactggcacaaaggctgg
aattggacctcagggattaatgagtgtccggccggggccctctgcagcacctttgagtcc
tacttccccactccagccgccctttgtgaaggcctctggagccactccttcaaggtcagc
aactatagtcgagggagcggccgctgcatccagatgtggtttgactcagcccagggcaac
cccaatgaggaggtggccaagttctatgctgcggccatgaatgctggggccccgtctcgt
gggattattgattcctga

DBGET integrated database retrieval system