KEGG   Homo sapiens (human): 23523Help
Entry
23523             CDS       T01001                                 

Gene name
CABIN1, CAIN, KB-318B8.7, PPP3IN
Definition
(RefSeq) calcineurin binding protein 1
  KO
K17613  calcineurin-binding protein cabin-1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23523 (CABIN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     23523 (CABIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MEF2_binding TPR_2 TPR_8 TPR_11 TPR_1 FAT TPR_9
Motif
Other DBs
NCBI-GeneID: 23523
NCBI-ProteinID: NP_001186210
OMIM: 604251
HGNC: 24187
Ensembl: ENSG00000099991
Vega: OTTHUMG00000150797
Pharos: Q9Y6J0(Tbio)
UniProt: Q9Y6J0 A0A024R1E5
Structure
PDB: 

Position
22q11.23
AA seq 2220 aa AA seqDB search
MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYH
ELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLD
STDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYF
ICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSIHDVSVSAAETQAIVDEA
LGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDL
SDYQDPSQPLESSMVVTPVNVIQPSTVSTNPAVAVAEPVVSYTSVATTSFPLHSPGLLET
GAPVGDISGGDKSKKGVKRKKISEESGETAKRRSARVRNTKCKKEEKVDFQELLMKFLPS
RLRKLDPEEEDDSFNNYEVQSEAKLESFPSIGPQRLSFDSATFMESEKQDVHEFLLENLT
NGGILELMMRYLKAMGHKFLVRWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKD
MMLMSLSCMELQLDQWLLTKGRSSAVSPRNCPAGMVNGRFGPDFPGTHCLGDLLQLSFAS
SQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQALENYDICTEMLQSSTAIQVEAGAERR
DIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLEEIQRLYEAGDYKAVVHLLRPTLCTSG
FDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDYRQCFECSDVALNEAVQQMVNSGEAAAK
EEWVATVTQLLMGIEQALSADSSGSILKVSSSTTGLVRLTNNLIQVIDCSMAVQEEAKEP
HVSSVLPWIILHRIIWQEEDTFHSLCHQQQLQNPAEEGMSETPMLPSSLMLLNTAHEYLG
RRSWCCNSDGALLRFYVRVLQKELAASTSEDTHPYKEELETALEQCFYCLYSFPSKKSKA
RYLEEHSAQQVDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTE
RPALSLDKVSAYIEGTSTEVPCLPEGADPSPPVVNELYYLLADYHFKNKEQSKAIKFYMH
DICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWKHATPVLNCFRRALEIDSSNL
SLWIEYGTMSYALHSFASRQLKQWRGELPPELVQQMEGRRDSMLETAKHCFTSAARCEGD
GDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA
LEVYFRLHASILKLLGKPDSGVGAEVLVNFMKEAAEGPFARGEEKNTPKASEKEKACLVD
EDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQATPDDRSQDSTA
VALSDSSSTQDFFNEPTSLLEGSRKSYTEKRLPILSSQAGATGKDLQGATEERGKNEESL
ESTEGFRAAEQGVQKPAAETPASACIPGKPSASTPTLWDGKKRGDLPGEPVAFPQGLPAG
AEEQRQFLTEQCIASFRLCLSRFPQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSSIPW
QQLQHMPAQGLFCERNKTNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHS
TLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSERPGPKVCG
LPGARMTTDVSHKASPEDGQEGLPQPKKPPLADGSGPGPEPGGKVGLLNHRPVAMDAGDS
ADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
ELSISARQQPTPLTPAQPAPAPAPATTTGTRAGGHPEEPLSRLSRKRKLLEDTESGKTLL
LDAYRVWQQGQKGVAYDLGRVERIMSETYMLIKQVDEEAALEQAVKFCQVHLGAAAQRQA
SGDTPTTPKHPKDSRENFFPVTVVPTAPDPVPADSVQRPSDAHTKPRPALAAATTIITCP
PSASASTLDQSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTSFPPQEPRHSPQVKM
APTSSPAEPHCWPAEAALGTGAEPTCSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAAS
SKAPSSGSAQPPEGHPGKPEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSP
KGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI
NT seq 6663 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaattgcagccttaaatgccagctccaccattgaggatgatcatgaaggaagc
tttaaaagtcacaaaacccagacaaaggaggctcaggaagcagaggcttttgcattgtac
cacaaggcccttgatctgcagaaacatgaccggtttgaggagtctgccaaagcctaccat
gagctcttggaggcgagcctgctgcgggaggcagtttcatccggtgatgagaaagagggg
ttgaaacaccctgggctgatactgaaatattccacttataagaacttggcccagctggca
gcccagcgggaggatctggagacagccatggagttctacttagaggcagtgatgctggac
tccacagatgtcaacctctggtataagattggacatgtggccctgaggctcatccggatc
cccctggctcgccatgcttttgaggaagggctgcggtgcaatcctgaccactggccctgt
ttggataacctaatcactgtcctgtacaccctcagtgattacacaacatgtctgtacttc
atctgcaaagctttggagaaggattgccggtacagcaaagggctggtcctcaaggagaag
atttttgaggagcagccttgtctccggaaggactctctcagaatgttcctcaaatgtgac
atgtcgattcacgatgtttcggtgagtgcagctgagacacaggcgattgtagatgaggcc
ttggggctgcgaaaaaagaggcaagcgctgattgtgcgggagaaggagccggacctgaaa
cttgtgcagcccattcctttcttcacctggaagtgcctcggagagagcttgctggccatg
tacaatcatctcaccacctgtgagcccccacgtcccagccttggcaaaaggattgatttg
tcggactaccaggaccccagccagcctcttgagtcctccatggtggtgacgccagttaac
gtgatccagccaagcactgtcagcaccaacccagctgtggctgtcgccgagcctgtggtc
tcctacacctctgtggctacaaccagcttcccactgcacagtcctggtctgttggagaca
ggcgctcctgtgggtgatatttctgggggagataaatccaagaaaggggtaaaacggaag
aagatttcagaagagagtggagaaacagcaaagcggcggtctgcccgtgtccgaaacacc
aagtgcaaaaaagaagagaaagtagacttccaggagcttctgatgaagttcttgccgtcc
aggttaagaaagctggaccctgaggaggaagatgattcctttaataactatgaagtccag
tcagaagccaaactggaaagcttcccaagcattgggcctcaaaggctgtcatttgactca
gccacattcatggaatctgaaaagcaggacgtgcatgagttcctgctggagaacctaacc
aacgggggcatcctggagctgatgatgcgctacctgaaagccatgggccacaagttcttg
gtaaggtggcctccaggcttggcggaggtcgtgctcagcgtctaccacagctggaggagg
cacagcaccagcctgcccaacccgctgctgagggactgcagcaacaagcacatcaaggac
atgatgctgatgtctctctcctgcatggaactccagctggaccagtggctgctgaccaaa
ggcagaagctctgcagtgtctcctcggaactgccctgctggtatggtgaatggcagattt
ggacctgacttcccagggacccactgcctgggtgacctcctacagctgtcatttgcctcg
tcccagcgcgacctgttcgaggatggttggctggagtttgtggtccgtgtttactggctg
aaggctcgcttcctggcgctgcagggagacatggagcaggccctggagaactatgacatc
tgcacagaaatgctccagagttccaccgccatccaggtggaggcaggggctgaacgaaga
gacattgtcatccggctgcccaacctccataatgactctgtggtttccctggaggagatt
gataagaacctgaagtcgctggagcggtgccagtccctggaggagattcagcggctgtat
gaagcaggcgactacaaggctgttgtgcatctgctccgccccactttgtgcaccagtggg
tttgaccgggccaaacacctggagtttatgacttccattcctgagaggccagcccagctg
cttcttctgcaggactccttgctccggctgaaggactatcggcagtgttttgagtgttcc
gatgtggctctgaacgaggctgtccagcagatggtgaactcaggtgaggctgccgccaag
gaggagtgggtggccacagtgacccaactgctgatgggcatcgagcaggccctctctgcg
gacagcagtggtagcatcctgaaggtatcatcctccaccactggccttgtgcggctcacc
aacaacctcatccaggtcattgactgcagcatggctgtgcaggaggaggccaaggagccc
cacgtctcttcagtgctaccctggatcattctacaccggatcatctggcaggaggaagac
accttccattctctgtgccaccagcagcagctccaaaacccagcggaggaagggatgtca
gagacgcccatgctcccatcctccctcatgctgctgaacacagcccacgagtatttgggc
agaaggtcctggtgctgcaattcagatggggctctgctgcgattctatgtgcgagtactc
cagaaggaactggctgcatccacctctgaagacacgcacccttacaaggaggagctggag
acagccttggagcagtgcttctactgcctgtacagcttccccagcaagaagagtaaggcc
aggtacctggaggaacactcggcccagcaggtggatcttatatgggaggatgcactgttc
atgtttgagtattttaagcccaagacccttcctgaatttgacagctataagaccagcacc
gtgtctgctgacttggccaacctactgaagagaattgccaccattgtgcctcgcacagag
aggccagcccttagcctggacaaagtctctgcctacattgagggaacttcaactgaggta
ccctgcctcccagagggggctgacccctcccctccagtggtgaacgagctttactacctc
ctggctgattatcatttcaaaaacaaggagcagtccaaggccatcaagttctacatgcat
gacatctgcatctgccccaataggtttgattcctgggcaggcatggctctggcccgggcc
agccgcattcaggacaagctgaactccaatgagctgaagagtgatgggcccatttggaag
catgccacgcccgtcttgaactgcttccgtcgggccctggagattgacagctccaacttg
tccctatggattgagtatggcaccatgtcctatgccttgcactcattcgcctcacgtcaa
ttgaagcagtggagaggcgagctgccccctgagctcgtgcagcagatggagggccggcgc
gacagcatgctagagacagccaagcactgtttcacatcagcagcccgctgcgagggtgat
ggtgacgaggaggagtggctcatccactacatgctgggcaaggtggctgagaagcagcag
cagccacccaccgtttacttgctgcactacaggcaggctggccactacctgcacgaggag
gctgcccgctaccccaagaagatccactaccacaacccacctgagctggccatggaggcc
ctggaggtgtactttcggctccatgcttccatcctgaagctcctggggaagcccgattct
ggggttggtgcagaggtcctggtcaactttatgaaggaggctgcagaaggaccctttgcc
aggggcgaggagaagaacacacccaaagcttcagaaaaggagaaggcctgcctggtggac
gaggactcccactcttcagctgggacactgccgggccccggagcctccctcccctcctcc
tctggcccaggtctgacatccccaccttacacagccactccgattgaccacgattacgtc
aaatgtaaaaaaccccaccagcaggcaacgccggacgaccgaagccaggacagcacagcc
gtagcactctcagactctagctcaacgcaggacttctttaatgagcccaccagcttactg
gaaggctccaggaaatcctacacagagaagaggctgcccattctcagttcccaagcagga
gcgacgggtaaagatcttcagggggccacagaagaaagaggaaaaaacgaggagtcattg
gagagtacagaaggcttccgggctgcagagcaaggtgtccagaagcctgctgcagaaacc
ccagcctctgcttgcatccctggcaagccctcagcatccacacccaccctgtgggatggg
aagaagagaggggacctcccaggggagccagtggccttcccccaggggctgccggctggt
gctgaggagcagcggcagtttctcacagagcagtgcatcgcctccttccgcctgtgcctg
agccgcttcccccagcactataagagtctctaccgtctggccttcctctacacctacagc
aagacccaccggaacctccagtgggcccgcgacgtgttgctaggcagcagtatcccgtgg
caacaactgcagcacatgccggcacaggggctcttctgcgagaggaacaagaccaatttc
ttcaacggcatctggcggatccccgtggacgagattgaccggccgggcagctttgcctgg
cacatgaaccgctccatcgtgctgctgctcaaggtgctggcccagctgcgggaccacagc
accctgctgaaggtgtcctccatgcttcagcggaccccagaccagggcaagaagtatctg
cgagatgctgaccgccaggtcctggcgcagcgggccttcatcctcactgtgaaggtgctc
gaagacacgctgagcgagctcgcagaggggtcagaacgcccagggcccaaggtctgtggc
ctccccggagccaggatgaccaccgatgtctcacacaaggccagtcctgaggatggccag
gagggcctcccccagccgaagaagccccctctggctgatggctcagggccagggcccgag
ccaggaggcaaagtgggcctcctcaaccaccggcctgtggccatggatgcaggagacagt
gcagaccaaagcggggagcggaaggataaagagagcccacgggcagggcccactgagccc
atggacacgagtgaggccactgtttgccactcagacttggagcggacaccacccctgctg
ccaggtcgccccgcaagggaccggggccccgagagccggcccactgagctgtccctggag
gagctgagcatcagtgcccggcagcagcccaccccgctcaccccagcccagccagccccc
gcccccgcccccgccaccaccacagggaccagggcagggggccacccggaggagccgctc
tcccggctcagccgcaagaggaagctcctggaggacacagagtcaggcaagacacttctg
ttggatgcctaccgtgtgtggcagcagggccagaagggtgtggcctatgacctgggccgt
gtggagaggatcatgtcggagacctacatgctcatcaagcaggtggatgaggaggctgcg
ctggagcaggctgtgaagttctgccaggtccatcttggggctgccgcccagagacaggcc
tcgggggacacccccaccactccaaagcaccccaaagacagccgagagaacttctttcct
gtgacagtggtgcccacagcccctgaccctgtgccagctgactctgtccagcggcccagt
gatgctcacaccaagcctcgccctgcactagctgccgccacaactattatcacctgccct
ccgtcagcatcagcttccaccctggaccagtccaaggaccctgggcctccccggccacac
aggcctgaagctacccccagcatggcctctctgggcccagagggagaagagctggcgaga
gtggcagagggcaccagcttcccgcctcaggagccacggcacagtccgcaggtgaagatg
gcccccacaagttccccggcagagccacactgctggccggcagaggctgccctgggcaca
ggcgctgagcccacctgcagccaggaggggaaactgaggcctgagccgagaagggatggg
gaggctcaggaggctgcgagtgagactcagcccctgagctctcccccaacagctgccagc
tccaaggcccccagcagtgggagtgcccagccaccagagggtcacccaggcaagcctgag
cccagccgggctaagtcccgccccctgcccaacatgccaaagctggtcatcccctccgcc
gccaccaagttcccccctgagatcaccgtcacgccacccaccccaaccctgctctccccc
aaaggcagcatctcggaggagaccaagcagaagctgaagtcagccatcctttctgcccag
tctgctgccaacgtgaggaaggagagcctatgccagccagccctggaggtcctggagaca
tccagccaggagtcctcgctggagagcgagacagacgaggacgacgactacatggacatt
tga

DBGET integrated database retrieval system