KEGG   Homo sapiens (human): 23526
Entry
23526             CDS       T01001                                 

Gene name
ARHGAP45, HA-1, HLA-HA1, HMHA1
Definition
(RefSeq) Rho GTPase activating protein 45
  KO
K20644  Rho GTPase-activating protein 29/45
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23526 (ARHGAP45)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    23526 (ARHGAP45)
SSDB
Motif
Pfam: RhoGAP C1_1 FCH
Other DBs
NCBI-GeneID: 23526
NCBI-ProteinID: NP_036424
OMIM: 601155
HGNC: 17102
Ensembl: ENSG00000180448
Vega: OTTHUMG00000181871
Pharos: Q92619(Tbio)
UniProt: Q92619
Position
19p13.3
AA seq 1136 aa
MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATG
TLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLL
ADVARFAEGLEKLKECVLRDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAA
GTLIAKVKAFHYESNNDLEKQEFEKALETIAVAFSSTVSEFLMGEVDSSTLLAVPPGDSS
QSMESLYGPGSEGTPPSLEDCDAGCLPAEEVDVLLQRCEGGVDAALLYAKNMAKYMKDLI
SYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEFGHSMVQAVGT
LQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYVQRCEDHDKAR
FLVAKAEEEQAGSAPGAGSTATKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQEL
EDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQY
ASHVRQLQRDQEPDVHYDFEPHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCT
EGTPAKDHRAGRGHQVHKSWPLSISDSDSGLDPGPGAGDFKKFERTSSSGTMSSTEELVD
PDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAARTHRLRKLRTPAKCRECNSY
VYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSHAARSAPDGVPFIVKK
CVCEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQL
PEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVALAGRLRELLRDLPP
ENRASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQA
RVIETLIVHYGLVFEEEPEETPGGQDESSNQRAEVVVQVPYLEAGEAVVYPLQEAAADGC
RESRVVSNDSDSDLEEASELLSSSEASALGHLSFLEQQQSEASLEVASGSHSGSEEQLEA
TAREDGDGDEDGPAQQLSGFNTNQSNNVLQAPLPPMRLRGGRMTLGSCRERQPEFV
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgttctccaggaagaaacgagagctcatgaaaaccccttccatctcgaaaaagaaccgc
gcgggaagccccagcccgcagccctcgggggagctgcccaggaaggatggggctgacgcg
gtgttccccggaccaagcctggagccgcccgctgggtcctccggcgtcaaggccacaggg
accctcaagcggcccaccagcctgagccgccacgccagcgcggctggcttccccctgtcg
ggtgctgcctcctggacactgggccggagccaccggagcccactgacagccgccagcccg
ggcgagctgcccaccgagggtgccggcccggacgtcgtcgaggacatctcccatctgctg
gcggacgtggcccgcttcgctgagggccttgagaaacttaaggagtgtgtgttgcgtgac
gacctccttgaggcccgccgcccgcgggcccacgagtgcctgggtgaggctctgcgtgtc
atgcatcagatcatctccaagtacccgctgctgaacaccgtggagacgctcaccgcagcc
ggcaccctcattgccaaggtcaaagccttccattatgagagcaacaatgatctggagaaa
caggagttcgagaaggccctggagacgattgctgtggccttcagtagcacagtgtccgag
ttcctcatgggtgaagtggacagcagcaccctcctagcagtgcctcctggggactcgagc
cagtccatggaaagcctgtatggaccgggcagtgagggcacgcctcccagcctggaagac
tgtgacgccggctgcctgcccgccgaggaggtggacgtgctgctacagcgctgtgagggg
ggcgtggatgccgcactgctgtatgccaagaacatggccaagtacatgaaggacctcatc
agctacctggagaagcggacgacgctggagatggagtttgccaagggcctgcagaagatc
gctcacaactgcagacagagcgtcatgcaggagccccacatgccgctcctgtccatctac
tcgctggccctggagcaggacctggagttcggccacagcatggtgcaggcggtgggcacc
ttgcagacccagaccttcatgcagcccctgaccctgcggcggcttgaacacgagaagcgc
aggaaggagatcaaggaggcctggcaccgtgcccagaggaagctgcaagaggcggagtcc
aacctgcgcaaggccaagcagggttacgtgcagcgctgcgaggaccacgacaaggctcgc
ttcctcgtggccaaggcggaggaggagcaggctggcagcgcgccgggagcaggcagcacg
gccaccaagaccctggacaagcggcggcggctggaggaggaggccaagaacaaggcggag
gaagctatggccacctaccgcacctgcgtggccgacgcgaagacgcagaagcaggagctg
gaggataccaaggtgacggcgctgcggcagatccaggaggtcatccggcagagcgaccaa
accatcaagtcggccacgatctcctactaccagatgatgcatatgcagacggcgccgctg
cccgtgcacttccagatgctgtgtgagagcagcaagctgtatgacccaggccagcagtac
gcctcccacgtgcgccagctgcagcgggaccaggagcccgatgtgcactacgactttgag
ccccacgtctccgccaacgcctggtcccccgtcatgcgtgcccggaagagcagcttcaac
gtgagtgatgtggcgcggccggaggctgccgggagccccccagaagaaggcgggtgcact
gagggcacacctgccaaggaccacagggccgggcgaggacaccaggttcacaagtcatgg
ccgctctcgatctcagactcggacagtgggctggaccccggccctggcgcaggggacttt
aagaagttcgagcggacgtcatccagtggtaccatgtcgtccacggaggagctggtggac
ccagacggtggagccggggcttcagcctttgagcaggctgacctcaacggcatgaccccc
gagctgccggtggccgtgcccagtggaccgttccgccacgaggggctgtccaaggcggcc
cgtactcaccggctccggaagctccgcacgcccgccaagtgccgcgagtgcaacagctac
gtctacttccagggtgctgagtgtgaagagtgctgcctggcctgccacaagaaatgtctg
gagacgctggccatacagtgcgggcacaagaagctgcaaggccgcctgcagctgttcggc
caggacttcagccacgcggcccgcagcgcccccgacggcgtgcccttcatcgtcaagaag
tgcgtctgcgagatcgagcggcgggcgctgcgcaccaagggcatctaccgggtcaatggg
gtaaagacacgcgtggagaagctgtgccaggccttcgagaacggcaaggagctggtcgag
ctgtcgcaggcctcgccccacgacatcagcaacgtcctcaagctctacctgcgtcagctt
cccgagccgctcatctccttccgcctctaccacgagctcgtagggctggccaaggacagc
ctgaaggcagaggccgaggccaaggcggcgtcccggggccggcaggacggctcggagagc
gaggcagtggcggtggccctggcaggtcggctgcgggagctcctgcgggacctgccgcct
gagaaccgggcctcgctgcagtacctgctgcgtcacctacgcaggatcgtggaggtggag
caggacaacaagatgacccccgggaacctgggcatcgtgttcgggcccacgctgcttcgg
ccacggcccaccgaggccaccgtgtccctctcctccctggtggattatccccatcaggcc
cgcgtcatcgagactctcatcgtccactacggcctggtcttcgaggaggagccggaggag
acccccgggggccaggacgagtcatccaaccagcgagctgaggtagtcgtccaggtgccg
tacctggaggcgggcgaggcggtggtctacccgctgcaggaggcggcggcggacgggtgc
agagaatcccgagttgtgtccaacgattcggactcggacctagaggaggcctccgagctg
ctgtcctcatcggaggccagtgccctgggccacctcagcttcctggagcagcagcagagc
gaggccagcctagaggtggcttctggcagccacagcggcagtgaggagcagctggaggcc
acagcccgggaggacggggacggggacgaggacggcccggcccagcagctctcaggattc
aacaccaaccagtccaacaacgtgctgcaggccccactgccccccatgaggctccgtggc
gggcggatgacactgggctcctgcagggaaaggcagccggaattcgtgtga

DBGET integrated database retrieval system