KEGG   Homo sapiens (human): 23528Help
Entry
23528             CDS       T01001                                 

Gene name
ZNF281, ZBP-99, ZNP-99
Definition
(RefSeq) zinc finger protein 281
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 FYVE
Motif
Other DBs
NCBI-GeneID: 23528
NCBI-ProteinID: NP_001268222
HGNC: 13075
Ensembl: ENSG00000162702
Vega: OTTHUMG00000035724
Pharos: Q9Y2X9(Tdark)
UniProt: Q9Y2X9
Position
1q32.1
AA seq 895 aa AA seqDB search
MKIGSGFLSGGGGTGSSGGSGSGGGGSGGGGGGGSSGRRAEMEPTFPQGMVMFNHRLPPV
TSFTRPAGSAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGF
LQSLVSIKQEKPADPEEQQSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSIL
HQHVQQQPAQHHRDVLLSSSSRTDDHHGTEEPKQDTNVKKAKRPKPESQGIKAKRKPSAS
SKPSLVGDGEGAILSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQ
KYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRL
LKHRRTCGEVIVKGATSAEPGSSNHTNMGNLAVLSQGNTSSSRRKTKSKSIAIENKEQKT
GKTNESQISNNINMQSYSVEMPTVSSSGGIIGTGIDELQKRVPKLIFKKGSRKNTDKNYL
NFVSPLPDIVGQKSLSGKPSGSLGIVSNNSVETIGLLQSTSGKQGQISSNYDDAMQFSKK
RRYLPTASSNSAFSINVGHMVSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKS
GIPDEVLQSILDQYSNKSESQKEDPFNIAEPRVDLHTSGEHSELVQEENLSPGTQTPSND
KASMLQEYSKYLQQAFEKSTNASFTLGHGFQFVSLSSPLHNHTLFPEKQIYTTSPLECGF
GQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSA
FQSSSQKLTSQKEQKNLESSTGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFK
SGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggcagtgggttcctgagtggcggcggaggtaccggcagtagcggtggtagc
ggctccggcggcggtggtagtggcggcggcggcggcggcggcagcagcggcaggagggca
gagatggaacccacctttccccagggtatggttatgttcaaccaccgtcttcccccggtc
accagcttcacccggccggcggggtcggccgcccctcccccgcaatgcgtgttatcctcc
tctacctccgcagccccggccgctgagcccccccctccgccagccccggacatgactttc
aagaaggagccggcggcgtcagccgcggccttcccctcgcagaggacctcctgggggttc
ttgcagtctttggttagcatcaaacaggagaaacccgcggatcctgaggagcagcagtcc
caccaccaccatcaccaccaccactatggggggctgttcgctggagctgaagagaggtct
ccaggcctaggaggcggtgaaggggggagtcacggcgtcatccaggacctcagtattctc
caccagcatgtccagcagcaaccagcccagcaccaccgtgacgtattactcagcagcagt
agcaggactgatgaccaccatggcactgaggagccaaagcaggacactaatgtcaaaaag
gcaaaaaggccaaagccagaatctcagggaatcaaagccaagaggaagccaagtgcatct
tccaaaccttctttggttggagatggagaaggtgccatcctctccccaagtcagaaacct
catatctgtgatcactgtagtgctgctttccgaagctcctatcacctgcggagacatgtc
ctcattcatacaggagaaagacctttccagtgcagccagtgtagtatgggtttcattcag
aaatacctactacagagacatgagaaaattcatagtagagagaagccatttggatgtgat
cagtgcagcatgaagtttattcagaagtaccatatggagagacacaagaggacacatagt
ggagaaaagccatataagtgtgacacttgccaacagtatttttcaaggactgatagattg
ttgaagcacaggcgcacatgtggtgaagtcatagttaaaggagccactagtgcagaacct
gggtcatcaaaccataccaatatgggtaatctggctgtgttgtctcagggaaatacaagt
tcttcaaggagaaaaacaaagtcaaaaagcatagctattgaaaataaggaacagaagacc
ggtaaaacaaatgaatcgcaaatttcaaataatataaacatgcagagttactcagtagaa
atgcctaccgtgtcttccagtggaggcataattggcactggaatagatgaactgcagaag
agggtgccaaaattgatctttaagaaaggaagcagaaagaatacagataaaaactacctt
aactttgtgtcaccattaccagacatagtaggacagaaatccttgtctggaaaaccaagt
ggctcacttggcatagtatcaaataatagtgtggagaccattggtcttctccaaagtaca
agtggcaaacaaggtcagataagtagtaattatgatgatgccatgcagttttcaaagaaa
agaagatatttaccaactgccagcagcaacagtgccttttctataaacgtaggacacatg
gtctcccaacagtctgtcattcagtctgcaggtgtcagtgttttggacaatgaggcacca
ttgtcacttattgactcctcagctctaaatgctgaaattaaatcttgtcatgacaagtct
ggaattcctgatgaggttttacaaagtattttggatcaatactccaacaaatcagaaagc
cagaaagaggatcctttcaatattgcagaaccacgagtggatttacacacctcaggagaa
cactcagaattggttcaagaagaaaatttgagcccaggcacccaaacaccttcaaatgat
aaagcaagtatgttgcaagaatactccaaatacctccaacaggcttttgaaaaatccact
aatgcaagttttactcttggacacggtttccaatttgtcagtttgtcttcacctctccac
aaccacactttgtttccagaaaaacaaatatacactacgtctcctttggagtgtggtttc
ggccaatctgttacctcagtgttgccatcttcattgccaaagcctccttttgggatgttg
tttggatctcagccaggtctttatttgtctgctttggatgctacacatcagcagttgaca
ccttcccaggagctggatgatctgatagattctcagaagaacttagagacttcatcagcc
ttccagtcctcatctcagaaattgactagccagaaggaacagaaaaacttagagtcttca
acaggctttcagattccatctcaggagttagctagccagatagatcctcagaaagacata
gagcctagaacaacgtatcagattgagaactttgcacaagcgtttggttctcagtttaag
tcgggcagcagggtgccaatgacctttatcactaactctaatggagaagtggaccataga
gtaaggacttcagtgtcagatttctcagggtatacaaatatgatgtctgatgtaagtgag
ccatgtagtacaagagtaaagacacccaccagccagagttacaggtaa

DBGET integrated database retrieval system