KEGG   Homo sapiens (human): 2353Help
Entry
2353              CDS       T01001                                 

Gene name
FOS, AP-1, C-FOS, p55
Definition
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04024  cAMP signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04713  Circadian entrainment
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05031  Amphetamine addiction
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05224  Breast cancer
hsa05231  Choline metabolism in cancer
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2353 (FOS)
   04668 TNF signaling pathway
    2353 (FOS)
   04024 cAMP signaling pathway
    2353 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    2353 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    2353 (FOS)
   04660 T cell receptor signaling pathway
    2353 (FOS)
   04658 Th1 and Th2 cell differentiation
    2353 (FOS)
   04659 Th17 cell differentiation
    2353 (FOS)
   04657 IL-17 signaling pathway
    2353 (FOS)
   04662 B cell receptor signaling pathway
    2353 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    2353 (FOS)
   04917 Prolactin signaling pathway
    2353 (FOS)
   04921 Oxytocin signaling pathway
    2353 (FOS)
   04926 Relaxin signaling pathway
    2353 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    2353 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    2353 (FOS)
   04728 Dopaminergic synapse
    2353 (FOS)
  09158 Development
   04380 Osteoclast differentiation
    2353 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2353 (FOS)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    2353 (FOS)
   05231 Choline metabolism in cancer
    2353 (FOS)
   05210 Colorectal cancer
    2353 (FOS)
   05224 Breast cancer
    2353 (FOS)
  09162 Immune diseases
   05323 Rheumatoid arthritis
    2353 (FOS)
  09164 Substance dependence
   05031 Amphetamine addiction
    2353 (FOS)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2353 (FOS)
  09167 Infectious diseases
   05132 Salmonella infection
    2353 (FOS)
   05133 Pertussis
    2353 (FOS)
   05166 HTLV-I infection
    2353 (FOS)
   05161 Hepatitis B
    2353 (FOS)
   05168 Herpes simplex infection
    2353 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    2353 (FOS)
   05140 Leishmaniasis
    2353 (FOS)
   05142 Chagas disease (American trypanosomiasis)
    2353 (FOS)
  09168 Drug resistance
   01522 Endocrine resistance
    2353 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2353 (FOS)
   04131 Membrane trafficking [BR:hsa04131]
    2353 (FOS)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    2353 (FOS)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    2353 (FOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Motif
Other DBs
NCBI-GeneID: 2353
NCBI-ProteinID: NP_005243
OMIM: 164810
HGNC: 3796
Ensembl: ENSG00000170345
Vega: OTTHUMG00000171774
Pharos: P01100(Tbio)
UniProt: P01100 Q6FG41
Structure
PDB: 

Position
14q24.3
AA seq 380 aa AA seqDB search
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg
tccccggccggggatagcctctcttactaccactcacccgcagactccttctccagcatg
ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcccgcc
ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccgcc
ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg
cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggttgccaccccggagtctgaggaggccttcacc
ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcatcagc
agcatggagctgaagaccgagccctttgatgacttcctgttcccagcatcatccaggccc
agtggctctgagacagcccgctccgtgccagacatggacctatctgggtccttctatgca
gcagactgggagcctctgcacagtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcagctgcccaccgcaag
ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system