KEGG   Homo sapiens (human): 23530
Entry
23530             CDS       T01001                                 
Symbol
NNT, GCCD4
Name
(RefSeq) nicotinamide nucleotide transhydrogenase
  KO
K00323  proton-translocating NAD(P)+ transhydrogenase [EC:7.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Disease
H00256  Familial glucocorticoid deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    23530 (NNT)
Enzymes [BR:hsa01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.1  proton-translocating NAD(P)+ transhydrogenase
     23530 (NNT)
SSDB
Motif
Pfam: PNTB AlaDh_PNT_C AlaDh_PNT_N PNTB_4TM Pyr_redox_2 ADH_zinc_N Pyr_redox
Other DBs
NCBI-GeneID: 23530
NCBI-ProteinID: NP_036475
OMIM: 607878
HGNC: 7863
Ensembl: ENSG00000112992
UniProt: Q13423
Structure
Position
5:43602675..43707396
AA seq 1086 aa
MANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVG
VPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVL
ASDLVVKVRAPMVNPTLGVHEADLLKTSGTLISFIYPAQNPELLNKLSQRKTTVLAMDQV
PRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGL
ASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAE
MKLFAQQCKEVDILISTALIPGKKAPVLFNKEMIESMKEGSVVVDLAAEAGGNFETTKPG
ELYIHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISPDKDNFYFDVKDDFDFGTMG
HVIRGTVVMKDGKVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMSTASAYT
AGLTGILGLGIAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAV
GGLALMGGHLYPSTTSQGLAALAAFISSVNIAGGFLVTQRMLDMFKRPTDPPEYNYLYLL
PAGTFVGGYLAALYSGYNIEQIMYLGSGLCCVGALAGLSTQGTARLGNALGMIGVAGGLA
ATLGVLKPGPELLAQMSGAMALGGTIGLTIAKRIQISDLPQLVAAFHSLVGLAAVLTCIA
EYIIEYPHFATDAAANLTKIVAYLGTYIGGVTFSGSLIAYGKLQGLLKSAPLLLPGRHLL
NAGLLAASVGGIIPFMVDPSFTTGITCLGSVSALSAVMGVTLTAAIGGADMPVVITVLNS
YSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRSLANVILGGYGTTSTAGG
KPMEISGTHTEINLDNAIDMIREANSIIITPGYGLCAAKAQYPIADLVKMLTEQGKKVRF
GIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINHDFPDTDLVLVIGANDTVNSAAQEDP
NSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPNTAMLLGDAKKTCDALQAKV
RESYQK
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggcaaacctattgaaaacagtggtgactggctgctcgtgtcctctacttagcaatttg
gggtcctgtaagggtctacgtgtgaagaaggattttttacgaacattttatactcaccaa
gaactgtggtgtaaagcgcctgtaaaaccaggaattccatataagcaactgactgttgga
gtccccaaagagatattccaaaatgagaagcgagtggcattgtctcctgctggtgttcag
aacttggtcaagcagggttttaatgttgtcgtggaatcgggtgcgggcgaagcttccaag
ttctcagatgatcactatagagtggcaggtgcccaaatccaaggggcaaaggaagtgctg
gcttctgatttggtggtcaaagtgcgagcccctatggttaatccaacattaggtgttcat
gaagctgaccttttaaagacatcaggaacgctgattagttttatttacccagcccaaaat
ccagagttgctaaataaactttcccaaagaaaaactacagttctggcaatggaccaggtt
ccaagagtcacaattgctcagggatatgatgcgctaagctccatggccaacattgcgggt
tataaggctgttgtcctagcagcaaatcattttggacgtttttttactggtcagatcaca
gctgctggaaaagttcctccagctaagattctgatagttggtggtggtgttgctgggctt
gcttctgcaggcgcagcaaagtcgatgggtgcaattgttcgaggatttgacacaagagct
gcagctttggaacagttcaagtctcttggtgctgagcccttggaggtggacttgaaggaa
tctggtgagggacaaggaggatatgcaaaagagatgtccaaagagttcattgaagctgaa
atgaaactctttgctcaacaatgcaaggaggtagacatccttatcagcacagcacttatt
ccaggtaaaaaagctccagttttatttaataaagaaatgattgagtcaatgaaggaaggt
tcagttgttgtggatttagctgctgaggctggtggaaactttgaaaccactaagccagga
gaactctacattcataagggaattactcacataggctacacagacctgcccagccgaatg
gccactcaggccagcaccctatattccaacaacatcaccaaactcctgaaggccatcagc
ccggacaaagataatttttattttgatgtgaaagatgactttgactttggtacgatgggt
catgtcattagaggaactgtagtgatgaaagatggtaaagtgattttcccagctcccaca
ccgaaaaatattcctcaaggtgccccagtaaaacagaagacagtggctgagctggaagct
gaaaaagcagctaccattacacccttcaggaagacaatgtcaacggcttctgcatataca
gcaggtctcacagggatactgggtttgggcattgcggctcccaatctagccttttctcag
atggtgaccacttttggcttggctggcattgtggggtatcataccgtctggggagtgacc
cctgctctccactcaccactgatgtctgtgacaaatgcaatctcagggctgactgcagtt
ggtgggttggcactgatgggaggacatttgtatccttccacaacttctcagggccttgct
gctcttgctgcattcatatcctctgtcaacattgcaggtggctttctggtgactcagaga
atgctggacatgttcaagcgtcccactgaccccccagaatacaactacctgtacctgctc
cctgccggcacctttgttggtggatatttagctgccctctacagtggttataacattgaa
cagatcatgtacctaggctcgggtttgtgctgtgtcggtgccttggctggcctctccacc
cagggaacagcacgtcttggcaatgcactgggcatgattggggttgctggaggactggca
gccaccctcggagtcctaaaaccgggcccagaattactagctcagatgtctggagcgatg
gctttgggtggtaccattggattgacaattgccaaacgcatccagatttctgatttacct
caattagttgctgcttttcacagtttagtgggtttggcagctgtacttacttgcatagct
gagtacattatagaatatccacattttgctacggatgcagcagcaaatctcaccaagatt
gtggcctacctcggcacttacattggtggcgtcacctttagtgggtctctcattgcctat
ggaaaattgcagggtctcctgaaatctgcccctctcctactgcctggaaggcacttactc
aatgcaggcttactggctgctagtgtgggcgggataatcccattcatggtggacccaagc
tttactactggcatcacctgtctgggttcagtgtctgctctctctgctgtcatgggtgtg
actttgacagctgctattgggggtgctgacatgcccgtcgttatcactgtgctgaacagc
tactcaggctgggccctgtgtgcagagggcttcctgctcaacaacaatctgctgaccatc
gtgggtgcactcataggctcgtctggtgctatcctgtcatacatcatgtgtgtggcaatg
aatcgctccctggctaatgtgattcttggaggctatggcaccacttcaacagctggtgga
aaacccatggaaatttctggcacacatacggaaatcaaccttgacaatgcaattgacatg
attcgagaagctaatagcattattattacaccaggctatggtctctgtgcagccaaagct
caataccccattgctgatttggtaaagatgctcactgagcaaggcaaaaaagtcaggttt
ggaattcacccagttgcaggccgaatgcctggtcagcttaatgtgctgctggctgaggct
ggtgtgccatatgacattgtgttggaaatggatgagatcaaccatgattttccagatact
gatttggtccttgtaattggagctaatgacactgttaattcagcagctcaagaagatccc
aactctattattgcaggcatgccagtccttgaggtctggaaatcaaagcaggtgattgtt
atgaagaggtctttgggtgttggctatgctgcagtggacaatccaatcttctacaaacct
aacacggccatgcttctaggtgatgccaagaaaacatgtgacgcgctccaggcgaaagtt
agagaatcctatcagaagtaa

DBGET integrated database retrieval system