KEGG   Homo sapiens (human): 23533Help
Entry
23533             CDS       T01001                                 

Gene name
PIK3R5, F730038I15Rik, FOAP-2, P101-PI3K, p101
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04611  Platelet activation
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
hsa05145  Toxoplasmosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
Disease
H00848  Ataxia with ocular apraxia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    23533 (PIK3R5)
   04072 Phospholipase D signaling pathway
    23533 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    23533 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    23533 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    23533 (PIK3R5)
   04062 Chemokine signaling pathway
    23533 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    23533 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    23533 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    23533 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    23533 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    23533 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23533 (PIK3R5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    23533 (PIK3R5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_1B_p101 DUF2284 ApoC-I
Motif
Other DBs
NCBI-GeneID: 23533
NCBI-ProteinID: NP_001136105
OMIM: 611317
HGNC: 30035
Ensembl: ENSG00000141506
Vega: OTTHUMG00000108197
Pharos: Q8WYR1(Tbio)
UniProt: Q8WYR1 L7RT34
Position
17p13.1
AA seq 880 aa AA seqDB search
MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVAN
KLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAELEDIFTETAEAQELA
SGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHTIPIPVARCYTYSWSQDSFDI
LQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTSSLASHDSTLS
LASSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQK
FIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLP
QPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRR
LENNRPLLTRFFKLQFFYVPVKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTPW
EESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLL
YYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDG
DREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEV
VKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYK
PEKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaggggccacgacatgcacggaggaccgcatccagcatgccctggaacgctgc
ctgcatggactcagcctcagccgccgctccacctcctggtcagctgggctgtgtctgaac
tgctggagcctgcaggagctggtcagcagggacccgggccacttccttatcctccttgag
cagatcctgcagaagacccgagaggtccaggagaagggcacctacgacctgctcaccccg
ctggccctgctcttctattccactgttctttgtacaccacacttcccaccagactcggat
ctccttctgaaggcagccagcacctaccaccggttcctgacctggcctgttccttactgc
agcatctgccaggagctgctcaccttcattgatgctgaactcaaggccccagggatctcc
taccagagactggtgagggctgagcagggcctgcccatcaggagtcaccgcagctccacc
gtcaccgtgctgctgctgaacccagtggaagtgcaggccgagttccttgctgtagccaat
aagctgagtacgcccggacactcgcctcacagtgcctacaccaccctgctcctgcacgcc
ttccaggccacctttggggcccactgtgacgtcccgggcctgcactgcaggctacaggcc
aagaccctggcagagcttgaggacatcttcacggagaccgcagaggcacaggagctggca
tctggcatcggggatgctgcagaggcccggcggtggctcaggaccaagctgcaggcggtg
ggagaaaaagctggcttccctggggtgttagacactgcaaaaccagggaagctccacacc
atccccatccctgtcgccaggtgctacacctacagctggagccaggacagctttgacatc
ctgcaggaaatcctgctcaaggaacaggagctactccagccagggatcctgggagatgat
gaagaggaggaagaggaggaggaggaggtggaggaggacttggaaactgacgggcactgt
gccgagagagattccctgctctccaccagctctttggcgtcccatgactccaccttgtcc
cttgcatcctcccaggcctcggggccggccctctcgcgccatctgctgacttcctttgtc
tcaggcctctctgatggcatggacagcggctacgtggaggacagcgaggagagctcctcc
gagtggccttggaggcgtggcagccaggaacgccgaggccaccgcaggcctgggcagaag
ttcatcaggatctataaactcttcaagagcaccagccagctggtactgcggagggactct
cggagcctggagggcagctcggacacggccctgcccctgaggcgggcagggagcctctgc
agccccctggacgaaccagtatcacccccttcccgggcccagcgctcccgctccctgccc
cagcccaaactcggtacccagctgcccagctggcttctggcccctgcttcacgcccccag
cgccgccgccccttcctgagtggagatgaggatcccaaggcttccacgctacgtgttgtg
gtctttggctccgatcggatttcagggaaggtggctcgggcgtacagcaaccttcggcgg
ctggagaacaatcgcccactcctcacacggttcttcaaacttcagttcttctacgtgcct
gtgaagcgaagtcatgggaccagccctggtgcctgtccaccccctcggagccagacgccc
tcacccccgacagactcccctaggcacgccagccctggagagctgggcaccaccccatgg
gaggagagcaccaatgacatctcccactacctcggcatgctggacccctggtatgagcgc
aatgtactgggcctcatgcacctgccccctgaagtcctgtgccagcagtccctgaaggct
gaagcccaggccctggagggctccccaacccagctgcccatcctggctgacatgctactc
tactactgccgctttgccgccagaccggtgctgctgcaagtctatcagaccgagctgacc
ttcatcactggggagaagacgacagagatcttcatccactccttggagctgggtcactcc
gctgccacacgtgccatcaaggcgtcaggtcctggcagcaagcggctgggcatcgatggc
gaccgggaggctgttcctctaacactacagattatttacagcaagggggccatcagtgga
cgaagtcgctggagcaacctggagaaggtctgtacctccgtgaacctcaacaaggcctgc
cggaagcaggaggagctggattccagcatggaggccctgacgctaaacctgacagaagtg
gtgaaaaggcagaactccaaatccaagaagggctttaaccagattagcacatcgcagatc
aaagtggacaaggtgcagatcatcggctccaacagctgcccctttgctgtgtgcctggac
caggatgagagaaagatcctgcagagtgtagtcagatgtgaggtctcaccgtgctacaag
ccagagaagagcgacctctcctcaccaccccagacgcctcctgacctgccggcccaggcc
gcacctgatctctgctcccttctctgcctgcccatcatgactttcagtggagctctgccc
tag

DBGET integrated database retrieval system