KEGG   Homo sapiens (human): 23534
Entry
23534             CDS       T01001                                 
Symbol
TNPO3, IPO12, LGMD1F, LGMDD2, MTR10A, TRN-SR, TRN-SR2, TRNSR
Name
(RefSeq) transportin 3
  KO
K15436  transportin-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03250  Viral life cycle - HIV-1
Disease
H00593  Limb-girdle muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    23534 (TNPO3)
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    23534 (TNPO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    23534 (TNPO3)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA transport factors
   tRNA import factors
    23534 (TNPO3)
SSDB
Motif
Pfam: Xpo1 Importin_rep_3
Other DBs
NCBI-GeneID: 23534
NCBI-ProteinID: NP_036602
OMIM: 610032
HGNC: 17103
Ensembl: ENSG00000064419
UniProt: Q9Y5L0 B3KMX1
Structure
Position
7:complement(128954185..129056193)
AA seq 923 aa
MEGAKPTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESC
YFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKDLSPVIVTQLALAIADLALQMP
SWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTV
VSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSSN
LHEAASDCVCSALYAIENVETNLPLAMQLFQGVLTLETAYHMAVAREDLDKVLNYCRIFT
ELCETFLEKIVCTPGQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEV
IHGIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECF
AQLYSTLKEGNPPWEVTEAVLFIMAAIAKSVDPENNPTLVEVLEGVVRLPETVHTAVRYT
SIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPLASAAAKAIHNICSVCRDHMAQHFNG
LLEIARSLDSFLLSPEAAVGLLKGTALVLARLPLDKITECLSELCSVQVMALKKLLSQEP
SNGISSDPTVFLDRLAVIFRHTNPIVENGQTHPCQKVIQEIWPVLSETLNKHRADNRIVE
RCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQG
LLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLRSQVVIPILQWA
IASTTLDHRDANCSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHT
CCFCLPPYTLPDVAEVLWEIMQVDRPTFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHK
QVTSAEECKQVCWALRDFTRLFR
NT seq 2772 nt   +upstreamnt  +downstreamnt
atggaaggagcaaagccgacattgcagctcgtgtaccaggcagtgcaggcgctttaccac
gacccagatcccagcggaaaggagcgcgcctctttttggcttggggagctgcagcgttcg
gttcatgcatgggagatctcagaccagttgttacagatccggcaggatgtggagtcatgc
tattttgctgcacagaccatgaaaatgaagattcagacctcattttatgagctccccaca
gactctcatgcctctttacgggactcattgctaacccatatccagaacttgaaagacttg
tcacctgttattgtaacgcagctggctttagcaatagcagatcttgccctacagatgcct
tcctggaagggatgtgtgcaaacactggtggaaaaatacagcaatgatgtgacttctttg
ccttttttgctggagatccttacagtgttacctgaagaagtacatagtcgttccttacga
attggagctaatcggcgcacagaaattatagaagatttggccttctactctagtacagta
gtatctctattgatgacctgtgtagaaaaagcaggaacagatgagaaaatgcttatgaag
gtttttcgctgtttgggaagttggtttaacttgggagttttggacagtaacttcatggct
aacaataaattactagcactcctttttgaggttttgcaacaggataagacctcgtctaac
ctacatgaagctgcttcggactgtgtatgctcagctctctatgccattgagaatgtggag
actaacttgccattagccatgcaactttttcagggagtgctgacattggagactgcctat
catatggccgtggcacgtgaagatttagacaaagttctgaattactgccgtattttcact
gaactatgtgaaacttttcttgaaaaaattgtttgtactccaggccaaggtcttggggac
cttcgaactctggagctgctgcttatctgtgcaggccatcctcaatatgaggtagtagaa
atttcatttaacttttggtaccgactgggggaacatttgtacaaaactaacgatgaagtt
attcatggcatcttcaaagcttacattcagaggctgcttcacgccttggctcgacactgc
cagctggaaccagaccatgagggggttcctgaggagactgatgactttggggagtttcgc
atgagggtatcagacctggtaaaggacttgattttcttgatagggtctatggagtgtttt
gctcagttatattctactctgaaagaaggcaacccaccctgggaggtgacagaagcggtt
ctctttatcatggctgctatagcaaagagtgttgatccggaaaacaatccaacacttgtg
gaagtcctagaaggagttgtccgcctcccggagaccgtacatacggctgtgcgatacacc
agcattgaattggttggagagatgagtgaagtcgttgatcgaaatcctcagttccttgac
cctgtgttgggctatttgatgaaaggcctgtgtgaaaagcccctggcttctgctgcagcc
aaagccattcataacatttgctctgtctgccgagatcacatggctcagcactttaatgga
ctcctggagattgcccgctccctcgattccttcctgttgtctccagaagctgctgtgggc
ttgctaaaagggacagcacttgtcctagcccgattacctttggataagattaccgaatgt
cttagtgaactatgttctgttcaggttatggcattgaaaaagctgttgtctcaagagccc
agcaatggcatatcctcagatcccacagtgttcttagatcgccttgcagtgatatttagg
cataccaatcccattgtggaaaatggacagactcatccgtgtcagaaagtcatacaggaa
atatggccagttttatccgagactctaaataagcaccgagctgataatcggattgtagag
cgttgttgcaggtgcctgcgctttgctgttcgctgtgtaggcaaaggatctgcagcactg
ctgcagccactagtcacacagatggtgaatgtgtaccacgtacatcagcattcctgcttc
ctgtaccttggcagtatccttgtggatgaatatggcatggaagaaggctgtcggcaggga
ctgctagacatgctccaggcactgtgcatccccacctttcagctcctagaacagcagaat
ggtctccagaatcaccctgacactgtagatgacctgttccggctagccaccaggtttatt
cagcgtagccctgtcaccttgctgcggagccaagtggtcatccctatcttacagtgggcc
attgcctctactaccctggaccaccgggatgccaattgtagtgtcatgaggtttctacga
gacctcattcatacaggggtagccaatgatcatgaagaagactttgaattacggaaagaa
ctgattggacaggtgatgaaccagcttggacagcagcttgtcagccagctgctgcacacc
tgctgcttttgcctccccccctataccctaccagatgtggctgaagtgctctgggagatc
atgcaggttgacagaccgactttttgtcgatggttagaaaattccttaaaaggtttgcca
aaggaaacaaccgtgggagccgtcacagtgacacacaaacaacttacagacttccacaag
caagtcactagtgctgaggaatgtaaacaagtttgctgggccttgcgagacttcaccagg
ttgtttcgatag

DBGET integrated database retrieval system