KEGG   Homo sapiens (human): 23536
Entry
23536             CDS       T01001                                 
Symbol
ADAT1, HADAT1
Name
(RefSeq) adenosine deaminase tRNA specific 1
  KO
K15440  tRNA-specific adenosine deaminase 1 [EC:3.5.4.34]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    23536 (ADAT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.34  tRNAAla(adenine37) deaminase
     23536 (ADAT1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Deaminases
    23536 (ADAT1)
SSDB
Motif
Pfam: A_deamin
Other DBs
NCBI-GeneID: 23536
NCBI-ProteinID: NP_001311374
OMIM: 604230
HGNC: 228
Ensembl: ENSG00000065457
Pharos: Q9BUB4(Tbio)
UniProt: Q9BUB4
Position
16:complement(75596868..75623281)
AA seq 502 aa
MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKE
VVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGT
QKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAP
GNERKCEDPDSPVTKKMRLEPGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGL
ATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCS
DKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQNVSALPKGFG
VQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVPEQPLDVTANGFPQGTT
KKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAW
STLRKQVFGSWIRNPPDYHQFK
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgtggaccgcggatgagattgctcagctatgctatgaacactatgggatcaggctgccc
aagaaggggaagcctgagccaaaccatgagtggacattattggcagcggtggtgaagata
caatctccagctgacaaggcctgcgacacccctgataagccggtgcaagtgacaaaggaa
gttgtgtcaatgggaacaggaacaaaatgcataggacagtccaaaatgaggaagaacgga
gacatcctcaatgatagccatgctgaggtcatagccagaaggagtttccaaaggtacctt
ctccaccaactccagttggcagccaccctgaaagaggatagcatctttgtcccaggaact
caaaaaggagtgtggaaacttagacgagacctcatttttgtgtttttctccagccataca
ccctgtggggatgcctccatcattccgatgcttgagtttgaagatcagccttgctgtcct
gtcttcagaaattgggcccacaactcatcagtagaagccagtagtaacctggaagctcct
ggaaatgaaagaaaatgtgaagaccctgacagtcctgtaaccaaaaagatgaggcttgag
cctgggactgcagccagggaggtcaccaacggagcagctcaccatcagagttttggcaag
cagaaaagtggcccaatctcaccaggcatccacagctgtgatctcactgtagagggactg
gctactgtcaccagaatagcccctggtagtgccaaagtgatagacgtttatagaactgga
gccaagtgtgtacctggagaagctggagactccggaaagccgggtgctgcgtttcaccag
gtggggctgctccgagtgaagccaggccgtggagacagaacacgctccatgtcctgtagt
gacaagatggcccgatggaacgtcctcggatgccaaggggcactgttgatgcacttgctg
gaagagcccatctacctgtcagctgtggtcattgggaagtgcccatacagccaggaagcc
atgcagagagcactgattggaaggtgtcagaatgtgtctgctttaccaaaaggcttcgga
gttcaagaattaaaaatactgcagtcagatttactatttgaacagagccgcagtgcggtg
caggcaaaaagggctgatagcccaggtcgacttgttccttgtggggcagccatcagctgg
agtgcagttcctgagcagcctttggatgttactgccaatggctttccacagggaacaaca
aagaaaacaattggaagccttcaggcaagatcccaaatcagcaaagtggaactcttcaga
tcattccagaagctgctaagcagaattgcaagggacaagtggccacactccctcagggtg
cagaagctggatacctaccaggagtacaaggaggctgcgtcctcttaccaggaagcctgg
agcacactccggaagcaggtgtttggatcctggatcagaaacccaccggattatcaccag
ttcaagtga

DBGET integrated database retrieval system