KEGG   Homo sapiens (human): 23544
Entry
23544             CDS       T01001                                 

Gene name
SEZ6L
Definition
(RefSeq) seizure related 6 homolog like
  KO
K24363   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Sushi CUB CUB_2 Lung_7-TM_R
Other DBs
NCBI-GeneID: 23544
NCBI-ProteinID: NP_066938
OMIM: 607021
HGNC: 10763
Ensembl: ENSG00000100095
Vega: OTTHUMG00000150870
Pharos: Q9BYH1(Tbio)
UniProt: Q9BYH1
Structure
PDB: 
2YRA

Position
22q12.1
AA seq 1024 aa
MPAARPPAAGLRGISLFLALLLGSPAAALERDALPEGDASPLGPYLLPSGAPERGSPGKE
HPEERVVTAPPSSSQSAEVLGELVLDGTAPSAHHDIPALSPLLPEEARPKHALPPKKKLP
SLKQVNSARKQLRPKATSAATVQRAGSQPASQGLDLLSSSTEKPGPPGDPDPIVASEEAS
EVPLWLDRKESAVPTTPAPLQISPFTSQPYVAHTLPQRPEPGEPGPDMAQEAPQEDTSPM
ALMDKGENELTGSASEESQETTTSTIITTTVITTEQAPALCSVSFSNPEGYIDSSDYPLL
PLNNFLECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVLANQTLLVEGQVI
RSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPRRPDSGDVTVMDLHSGGVAHFHCH
LGYELQGAKMLTCINASKPHWSSQEPICSAPCGGAVHNATIGRVLSPSYPENTNGSQFCI
WTIEAPEGQKLHLHFERLLLHDKDRMTVHSGQTNKSALLYDSLQTESVPFEGLLSEGNTI
RIEFTSDQARAASTFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFTCDPGHSL
EQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEGEDCIWKIHV
GEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHSD
PAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIV
GSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVL
EGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFM
CYEGFELMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAEAAAETSLEGGNMALA
IFIPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREY
EVSI
NT seq 3075 nt   +upstreamnt  +downstreamnt
atgcccgcggcccggccgcccgccgcgggactccgcgggatctcgctgttcctcgctctg
ctcctggggagcccggcggcagcgctggagcgagatgctcttcccgagggagatgctagc
cctttgggtccttacctcctgccctcaggagccccggagagaggcagtcctggcaaagag
caccctgaagagagagtggtaacagcgccccccagttcctcacagtcggcggaagtgctg
ggcgagctggtgctggatgggaccgcaccctctgcacatcacgacatcccagccctgtca
ccgctgcttccagaggaggcccgccccaagcacgccttgccccccaagaagaaactgcct
tcgctcaagcaggtgaactctgccaggaagcagctgaggcccaaggccacctccgcagcc
actgtccaaagggcagggtcccagccagcgtcccagggcctagatctcctctcctcctcc
acggagaagcctggcccaccgggggacccggaccccatcgtggcctccgaggaggcatca
gaagtgcccctttggctggaccgaaaggagagtgcggtccctacaacacccgcacccctg
caaatctcccccttcacttcgcagccctatgtggcccacacactcccccagaggccagaa
cccggggagcctgggcctgacatggcccaggaggccccccaggaggacaccagccccatg
gccctgatggacaaaggtgagaatgagctgactgggtcagcctcagaggagagccaggag
accactacctccaccattatcaccaccacggtcatcaccaccgagcaggcaccagctctc
tgcagtgtgagcttctccaatcctgaggggtacattgactccagcgactacccactgctg
cccctcaacaactttctggagtgcacatacaacgtgacagtctacactggctatggggtg
gagctccaggtgaagagtgtgaacctgtccgatggggaactgctctccatccgcggggtg
gacggccctaccctgaccgtcctggccaaccagacactcctggtggaggggcaggtaatc
cgaagccccaccaacaccatctccgtctacttccggaccttccaggacgacggccttggg
accttccagcttcactaccaggccttcatgctgagctgcaactttccccgccggcctgac
tctggggatgtcacggtgatggacctgcactcaggtggggtggcccactttcactgccac
ctgggctatgagctccagggcgctaagatgctgacatgcatcaatgcctccaagccgcac
tggagcagccaggagcccatctgctcagctccttgtggaggggcagtgcacaatgccacc
atcggccgcgtcctctccccaagttaccctgaaaacacaaatgggagccaattctgcatc
tggacgattgaagctccagagggccagaagctgcacctgcactttgagaggctgttgctg
catgacaaggacaggatgacggttcacagcgggcagaccaacaagtcagctcttctctac
gactcccttcaaaccgagagtgtcccttttgagggcctgctgagcgaaggcaacaccatc
cgcatcgagttcacgtccgaccaggcccgggcggcctccaccttcaacatccgatttgaa
gcgtttgagaaaggccactgctatgagccctacatccagaatgggaacttcactacatcc
gacccgacctataacattgggactatagtggagttcacctgcgaccccggccactccctg
gagcagggcccggccatcatcgaatgcatcaatgtgcgggacccatactggaatgacaca
gagcccctgtgcagagccatgtgtggtggggagctctctgctgtggctggggtggtattg
tccccaaactggcccgagccctacgtggaaggtgaagattgtatctggaagatccacgtg
ggagaagagaaacggatcttcttagatatccagttcctgaatctgagcaacagtgacatc
ttgaccatctacgatggcgacgaggtcatgccccacatcttggggcagtaccttgggaac
agtggcccccagaaactgtactcctccacgccagacttaaccatccagttccattcggac
cctgctggcctcatctttggaaagggccagggatttatcatgaactacatagaggtatca
aggaatgactcctgctcggatttacccgagatccagaatggctggaaaaccacttctcac
acggagttggtgcggggagccagaatcacctaccagtgtgaccccggctatgacatcgtg
gggagtgacaccctcacctgccagtgggacctcagctggagcagcgaccccccattttgt
gagaaaattatgtactgcaccgaccccggagaggtggatcactcgacccgcttaatttcg
gatcctgtgctgctggtggggaccaccatccaatacacctgcaaccccggttttgtgctt
gaagggagttctcttctgacctgctacagccgtgaaacagggactcccatctggacgtct
cgcctgccccactgcgtttcggaggagtccctggcatgtgacaacccagggctgcctgaa
aatggataccaaatcctgtacaagcgactctacctgccaggagagtccctcaccttcatg
tgctacgaaggctttgagctcatgggtgaagtgaccatccgctgcatcctgggacagcca
tcccactggaacgggcccctgcccgtgtgtaaagttaatcaagacagttttgaacatgct
ttagaagtagcagaagcggcagcagagacgtcgctggaaggggggaacatggccctggct
atcttcatcccggtcctcatcatctccttactgctgggaggagcctacatttacatcaca
agatgtcgctactattccaacctccgcctgcctctgatgtactcccacccctacagccag
atcaccgtggaaaccgagtttgacaaccccatttacgagacaggggaaaccagagagtat
gaggtttctatctaa

DBGET integrated database retrieval system